KEGG   Bacillus subtilis subsp. subtilis 168: BSU37180
Entry
BSU37180          CDS       T00010                                 

Gene name
fadF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: CCG Fer4_8 Fer4_7 Fer4_16 Fer4_9 Fer4_17 Fer4_10 Fer4_22 Fer4_2 Fer4 Fer4_21 DUF1467 Fer4_4 PsbY Fer4_6
Other DBs
NCBI-GeneID: 938461
NCBI-ProteinID: NP_391599
Pasteur: BG11311
BSORF: BG11311
UniProt: P45866 A0A6M3ZK18
Position
complement(3814382..3816499)
AA seq 705 aa
MSGFLIANALLFLIVTAYAVYLFVYLVKTRLAYIKLGQKEQFDQRFKERLHAIWVNVFGQ
KKLLKDKKSGIIHVMFFYGFILVQFGAIDFIIKGLAPGRNLSLGPVYPAFTFFQEIVTFL
ILIAVGWAFYRRYIEKLVRLKRGFKAGLVLIFIGGLMLTVLLGNGMNLIWHEHGLSWSEP
IASGIAFMLSGVGKTGAAVIFYIAWWIHLLFLLSFLVYVPQSKHAHLIAGPANVFFNRME
SAGKLEKIDFTDETKESYGAGKIEDFRQSQLLDLYACVECGRCTNMCPATGTGKMLSPMD
LILRLRDHLTEKGAAVTSRSPWVPAAAFRHTRGNQLAAASAGSGSQEAAAALDYNPSLIG
DVITEEEIWACTTCRNCEDQCPVMNEHVDKIIDLRRYLVLTEGKMDSDAQRAMTSIERQG
NPWGLNRKERENWRDEAPDAEIPTVKEMKKEGKEFEYLFWVGSMGSYDNRSQKIAISFAK
LLNHAGVSFAILGNKEKNSGDTPRRLGNEFLFQELAEKNISEFEKNDVKKIVTIDPHAYN
LFKNEYPDFGFEGEVYHHTEVLAELVKNGKLRPQHPLHETITFHDSCYLGRYNEVYDPPR
EILKAIPGVQLVEMERSRETGMCCGAGGGLMWMEEETGNRINVARTEQALAVNPSVISSG
CPYCLTMLGDGTKAKEAEDQVKTYDVVELLAQSVLGADLKMGEKQ
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgagcggctttctcatcgcaaatgcattattatttctgattgtaaccgcttacgctgtc
tatttgtttgtttacttggtcaaaacgagactggcctacatcaagctcggccagaaagaa
caatttgatcaacggttcaaggaacggcttcacgccatatgggtgaatgtattcggacag
aaaaaactgctcaaggacaagaaaagcggaatcattcacgtcatgtttttctacggattt
atattggttcagttcggagcaattgactttatcatcaaaggactggctcccggccggaat
ctgtcgcttggcccggtctatcccgccttcaccttttttcaggaaattgttacgtttctc
attttaattgctgttgggtgggcattctacagacgttatatcgaaaagctcgtgaggctg
aaacgcggtttcaaagccggactcgttctcatttttatcggaggattaatgctgaccgtt
ctgcttgggaacgggatgaatctgatttggcatgagcatgggctttcttggagcgagcca
attgcctcaggtattgcgtttatgcttagcggtgtcgggaaaacaggcgcggcggtgatt
ttctatatcgcatggtggatccatctcctattcttgcttagctttttagtgtacgtgcct
cagtcaaagcatgcccatttaatcgccggcccggcaaacgtctttttcaatcgaatggaa
tctgccggaaaacttgaaaaaattgattttaccgacgaaacgaaagaaagctacggagcg
ggaaaaattgaggatttcagacagtctcagctgcttgatctatacgcgtgtgtcgagtgc
ggccgctgtaccaatatgtgtcctgcaacaggcaccggaaaaatgctttctccgatggac
ttgattttgcgtctcagagaccatctcacggaaaaaggcgctgccgtcacctcgcgctcc
ccatgggtgcccgcagcagcgtttcggcatacgagaggcaatcagctggctgcggcgtca
gcgggcagcggatcgcaggaagccgcagcggcgcttgattacaatccaagcttgatcggc
gacgtcatcacagaggaagaaatttgggcatgcaccacttgccggaactgtgaggatcaa
tgcccggtcatgaatgagcacgtggataaaatcatcgacctccgccgctacctcgtactg
acagaaggaaaaatggacagtgacgcccagcgcgcaatgacaagtattgagcggcaaggg
aatccgtggggactcaaccgcaaggaacgtgaaaattggcgtgacgaggcgccggatgct
gagattccgactgtaaaagaaatgaaaaaagaaggaaaagaatttgagtaccttttctgg
gtaggctccatggggtcttacgacaacagaagccagaaaatcgcaatttcctttgccaag
ctgctcaatcacgcgggcgtgtccttcgcgattctcggcaataaagaaaaaaattcagga
gacacgccgcgccgcctcggaaatgaatttttgttccaagagctggctgagaagaatatt
tctgaatttgaaaaaaatgatgtcaaaaaaatcgttacgatcgatccccatgcatacaat
ttatttaaaaacgaatatccggatttcggatttgaaggcgaggtttatcatcatacagaa
gtgctggccgagcttgtgaaaaacggaaaattaagaccgcagcacccgcttcatgagacg
attaccttccatgattcgtgctatttgggccggtacaatgaagtctatgatccgccgaga
gagattttgaaagccattccgggcgtgcagcttgttgaaatggagagaagccgggaaacc
ggcatgtgctgcggagccggcgggggattaatgtggatggaggaagaaacaggcaacagg
attaacgtcgccaggacagagcaagcgctcgcagtcaacccatcggtgatcagttctggc
tgtccgtattgtctcacgatgcttggggacggcacaaaggcgaaggaagccgaagaccaa
gtcaaaacgtacgacgtcgtcgagcttctggctcaatccgttttaggcgctgatctgaaa
atgggggagaagcaatga

DBGET integrated database retrieval system