KEGG   Bacillus subtilis subsp. subtilis 168: BSU37190
Entry
BSU37190          CDS       T00010                                 

Symbol
clsB
Name
(RefSeq) cardiolipin synthetase
  KO
K06131  cardiolipin synthase A/B [EC:2.7.8.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU37190 (clsB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     BSU37190 (clsB)
SSDB
Motif
Pfam: PLDc_2 PLDc Regulator_TrmB APOBEC4_like
Other DBs
NCBI-GeneID: 938460
NCBI-ProteinID: NP_391600
Pasteur: BG11310
BSORF: BG11310
UniProt: P45865 A0A6M4JQ82
Position
3816654..3817850
AA seq 398 aa
MKVFIVIMIIVVIFFALILLDIFMGRAGYRKKAYEPVFSKKKSDIELIHCGADLVERMMN
DIRQAASSVHMMFFIMKNDEVSHNMYTLLKTKAQAGVSVYLLLDWAGCRAIKKTALQTMK
NAGVHVHVMNRPRFPFFFFHMQKRNHRKITVIDGKIGYIGGFNIAEEYLGKKAKFGNWED
YHLRMIGEGVHDLQTLFASDLKRNTGIELGSDVWPKLQQGTISHKIYATDGYSLENIYLA
NIAQAKNRLTVCTPYYIPSKPLQEALINARKNGVSVRIIVPMKSDHPLVREAAFTYYSEL
LDAGCLIYRYYQGFYHVKALIIDDHLSIIGTANFDKRSLFLNEEVNVEIDDEAFTSEVYA
TIEEDMKKSELLTMEDFSKRTFRQRPAEWLGRALSYFL
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaaggtatttatcgtgattatgatcattgtcgttattttctttgccttgattctgctt
gatatcttcatgggccgtgccggatacagaaaaaaggcgtacgagcctgttttttcaaaa
aagaagagtgacatcgaattgatccactgcggcgctgatctcgttgagcggatgatgaat
gatattcgccaggccgcctcttctgttcacatgatgttttttattatgaaaaatgatgag
gtcagccacaatatgtataccttgctgaaaacaaaagcccaagctggcgtatccgtttat
ttgcttctggattgggcgggctgccgggcaattaaaaaaacggcgcttcagacgatgaaa
aatgccggcgtccatgtccatgtgatgaatcgtccccgttttccttttttcttttttcac
atgcaaaaacggaatcaccggaagattacggtgatagacggaaaaatcggttatatcggc
gggtttaatatcgccgaagaatatcttggaaagaaggcgaagttcggcaattgggaggat
tatcatctgcgcatgatcggagaaggcgtacatgatcttcaaacgctttttgcttctgat
ctaaaacgaaataccggaatcgaactgggttcggatgtttggccaaagcttcagcaaggg
actatttctcacaagatctatgcgaccgacggttattcccttgaaaacatatacttggcc
aacattgcccaagcgaagaatcgccttacggtttgcacgccttattacattccatcaaaa
ccgcttcaagaggcccttattaacgcaagaaaaaacggcgtatccgtgagaatcattgta
ccgatgaaatcagaccatccgctggtacgagaagcggcttttacgtattattcggagctc
ttggatgccggctgtcttatttatcgttattatcaagggttttatcatgtaaaagccctc
atcatagacgaccatctcagcattatcggaacagccaacttcgataaacggagcctgttc
ttaaatgaagaggtgaatgttgaaattgatgacgaagcgtttacaagtgaagtctatgcc
acaattgaggaggatatgaaaaagtcggagctgctgacgatggaggatttcagcaagcgc
acattcaggcagcgcccggcggaatggctcggcagggcattatcttatttcttataa

DBGET integrated database retrieval system