KEGG   Bacillus subtilis subsp. subtilis 168: BSU37200
Entry
BSU37200          CDS       T00010                                 

Symbol
uvsE
Name
(RefSeq) UV DNA damage endonuclease
  KO
K13281  UV DNA damage endonuclease [EC:3.-.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU37200 (uvsE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     BSU37200 (uvsE)
SSDB
Motif
Pfam: UvdE AP_endonuc_2
Other DBs
NCBI-GeneID: 938195
NCBI-ProteinID: NP_391601
Pasteur: BG11309
BSORF: BG11309
UniProt: P45864 A0A6M3ZLE6
Position
3817863..3818825
AA seq 320 aa
MIFRFGFVSNAMSLWDASPAKTLTFARYSKLSKTERKEALLTVTKANLRNTMRTLHYIIG
HGIPLYRFSSSIVPLATHPDVMWDFVTPFQKEFREIGELVKTHQLRTSFHPNQFTLFTSP
KESVTKNAVTDMAYHYRMLEAMGIADRSVINIHIGGAYGNKDTATAQFHQNIKQLPQEIK
ERMTLENDDKTYTTEETLQVCEQEDVPFVFDFHHFYANPDDHADLNVALPRMIKTWERIG
LQPKVHLSSPKSEQAIRSHADYVDANFLLPLLERFRQWGTNIDFMIEAKQKDKALLRLMD
ELSSIRGVKRIGGGALQWKS
NT seq 963 nt   +upstreamnt  +downstreamnt
atgattttcagattcgggttcgtttcaaatgcgatgagcctttgggatgcgtctcccgct
aaaacattgacattcgcgcgttattcaaagctttcaaagactgaaagaaaagaagcgctt
ctgactgtgacaaaagccaatttgcgcaatacgatgagaacccttcactatatcatcggc
cacggcattcctttgtaccgtttttccagttcgattgtgccgctggctacgcatcccgac
gtgatgtgggattttgtaacaccgtttcaaaaagagtttcgggagattggagagcttgtt
aaaacccatcaactgcgaacaagctttcatccaaatcaattcactctgtttacgagcccg
aaggaatccgtcacaaaaaatgcggtaacagatatggcgtatcactaccgcatgcttgag
gccatgggcattgctgatcgctccgttatcaacattcatattggcggcgcttacggaaat
aaagacaccgccactgcacaatttcatcaaaatataaaacagctgccgcaggagatcaaa
gagcggatgacacttgaaaatgatgataaaacatatacaacggaagaaacgcttcaggtc
tgtgagcaggaggatgttccgtttgtctttgactttcatcatttttacgccaatccagac
gatcacgccgacctgaatgtagcactgccccgcatgatcaaaacgtgggagcggatcggc
cttcagccaaaggttcacttgtcttccccaaaatcggagcaagcgatacgcagccacgcc
gattatgttgacgccaactttttgctgccactgttggaacgctttaggcaatggggaact
aatattgatttcatgattgaagcaaagcagaaagacaaggcgcttctccgcttgatggat
gaattaagctccatccgcggtgtcaaacgcatcgggggcggtgcgctgcaatggaagtca
taa

DBGET integrated database retrieval system