KEGG   Bacillus subtilis subsp. subtilis 168: BSU37210
Entry
BSU37210          CDS       T00010                                 

Symbol
ywjC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TBK1_ULD Pox_A51 MID_MedPIWI
Other DBs
NCBI-GeneID: 938458
NCBI-ProteinID: NP_391602
Pasteur: BG11308
BSORF: BG11308
UniProt: P45863 A0A6M3ZI40
Position
3818906..3819178
AA seq 90 aa
MKNIKSLKVAAQAFTLRNLIHLYKMCHSGSHEVYIYSKKTMCKIKSLIELETFRMAHNEK
EYLIVVEGTKASQLIEKFQNLIEPAEREAL
NT seq 273 nt   +upstreamnt  +downstreamnt
atgaaaaatatcaagtctctgaaagtagccgcacaggcctttactttaagaaatttgatt
catctttataaaatgtgccattccggaagccacgaggtttatatttattcaaagaaaacg
atgtgcaaaatcaaaagcttaattgagcttgaaacgttccgcatggctcataatgaaaag
gaatatctgatcgtagttgaaggaacaaaagcatcacagctcattgaaaaattccaaaat
ctcatcgagcctgctgagagagaagcgctctaa

DBGET integrated database retrieval system