KEGG   Bacillus subtilis subsp. subtilis 168: BSU37220
Entry
BSU37220          CDS       T00010                                 

Symbol
ywjB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: RibD_C DHFR_1
Other DBs
NCBI-GeneID: 938455
NCBI-ProteinID: NP_391603
Pasteur: BG11307
BSORF: BG11307
UniProt: P45862 A0A6M4JQ61
Position
complement(3819220..3819744)
AA seq 174 aa
MERKTVLYIAVSLDGMIAKEDGSIDWLDEFEGEGDNGYSDFYQTVDTVILGRSTYEHVKV
LTPVFPYQDKTCYVFTGSPDSYQDEHVTFINEGARAFTARLKQEKGSNIWIAGGAELVND
FMKEDAIDEFIITVIPVVLGSGIPLFHELTNETKLRLKGTKQFGQAVQLHYVRA
NT seq 525 nt   +upstreamnt  +downstreamnt
atggaaagaaaaactgtgctgtacattgctgtttcattggacgggatgatcgcaaaagaa
gatggaagcatcgattggctggatgaatttgaaggtgaaggtgacaacggctacagtgat
ttttatcagactgttgatacagtcattttagggcggagcacatatgagcacgttaaagtg
ctaacaccggttttcccgtatcaggataaaacctgctatgtttttacaggatcgcccgac
agttatcaagatgaacatgtgacgtttatcaatgagggagccagagccttcactgcccgt
ttgaaacaggaaaaaggctcaaacatctggatagctggcggggcagagcttgtgaatgac
tttatgaaagaagatgccatcgacgaattcatcatcactgttattcccgtcgttttagga
agcggcatcccgctgtttcacgaactaacaaatgaaacaaaactgcggttaaaagggaca
aaacaatttggacaagcggttcagctccattatgtaagagcataa

DBGET integrated database retrieval system