KEGG   Bacillus subtilis subsp. subtilis 168: BSU37240
Entry
BSU37240          CDS       T00010                                 

Symbol
ywiE
Name
(RefSeq) cardiolipin synthase YwiE
  KO
K06131  cardiolipin synthase A/B [EC:2.7.8.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU37240 (ywiE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     BSU37240 (ywiE)
SSDB
Motif
Pfam: PLDc_2 PLDc PLDc_N DUF3810
Other DBs
NCBI-GeneID: 938453
NCBI-ProteinID: NP_391605
Pasteur: BG11305
BSORF: BG11305
UniProt: P45860 A0A6M4JQ59
Position
complement(3821570..3823072)
AA seq 500 aa
MLKRRLEFFFLYMMLIGAYVIWFFPVSRLEFYGGLLCYISIILFSIYSLILENRTSQHTL
LWIHILVFFPIVGYVFYLFSGQLYVKGKLFKTKRMYNREKLRKLFDKEETPEVTGLKDNQ
ERFFTYSIRAAHMNINTKSNIKVLKNGEETFPDIFKAMRKAESYIHIEYYMFKSDMLGRG
MMDIMMEKARQGVEVRFLYDAAGSMKLARRDIMRMKQAGVDIVPFSPLKYGFFNQKLNFR
NHRKIVIIDGKTGFVGGLNVGKEYISRDPYIGFWRDTHLRLEGEIVQTLHAIFMLDWEYV
SNEVLIDQEEYNTPVPVEGGGIYQIVATGPDMKESMSDLYYEMISSAQKSIWIATPYFVP
NESIRTALKAAATKGVEVRVMVPEKNDSFLTQYASRSYFPELLLEGIEVYSYQKGFMHQK
VMIIDGDLASVGTANMDMRSFQLNFEVNVFFTDAEAIRTLEAHFEEDMQESEKLSPVGFY
KRGVADRTKESFARLFSGVL
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgctgaaaaggagactggaatttttctttttatatatgatgctcatcggggcatatgtc
atttggttttttccggtttccagacttgagttttacggaggattgctttgctatataagc
attattttgttcagcatctattcattaattcttgaaaaccgcacctcgcagcacacgctg
ctatggatccatattcttgtcttttttccaatcgtcggctacgtgttttatctgttttcg
ggacagctttatgtaaagggaaagctgtttaagacaaaacgaatgtacaacagggaaaag
ctcaggaagctgtttgacaaggaggaaacgcccgaagtgacagggctgaaggacaatcaa
gagaggttctttacatattccatcagggctgcccatatgaatatcaatacgaaaagcaac
atcaaagtgctgaaaaacggcgaagaaaccttcccggacattttcaaagcaatgagaaaa
gcggaatcttacatacatattgaatactacatgtttaaatcagacatgctcggacgcggc
atgatggatattatgatggagaaagcgcgccagggtgtcgaggtgaggtttttatacgat
gcggcaggaagcatgaagctggcaagaagagatattatgagaatgaaacaagcgggggtg
gacatcgtcccgttttctccgctgaaatacgggtttttcaaccagaagctgaatttcaga
aatcaccggaaaatcgtgatcatcgatgggaaaaccggttttgtgggtggattaaatgtc
gggaaggaatatatcagcagagatccgtacatcggattttggagagatacacacctgcgg
cttgagggggaaattgtgcaaacgctccacgctatctttatgctggattgggaatatgtc
tccaatgaagtgctaattgatcaagaggagtacaataccccggttcccgtggaaggagga
ggcatttatcaaattgtcgcgacaggccctgacatgaaggaaagcatgagcgacctttat
tatgaaatgatttcttcagcgcagaaatcaatatggatcgccacgccctattttgtcccc
aatgaatccattcgcacggcgctaaaagcagcggcgacaaagggggtagaggtaagggtt
atggtgccggagaagaacgacagctttttgacccaatacgcgtcgaggtcctatttcccg
gagctgctccttgagggcattgaagtgtactcctaccaaaaaggcttcatgcatcaaaaa
gtcatgatcattgatggcgatctcgcctccgtcggtaccgcgaatatggacatgcgcagc
tttcagctcaactttgaagtgaatgtgttcttcacggatgccgaagcgatccgaaccctt
gaggcccattttgaagaggatatgcaggaaagtgaaaagctcagccctgtcggcttttat
aaaagaggtgtggctgaccggacaaaagagtcgtttgcccgcctgttttcaggtgttctg
taa

DBGET integrated database retrieval system