KEGG   Bacillus subtilis subsp. subtilis 168: BSU37250
Entry
BSU37250          CDS       T00010                                 

Symbol
narI
Name
(RefSeq) nitrate reductase gamma chain
  KO
K00374  nitrate reductase gamma subunit [EC:1.7.5.1 1.7.99.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu02020  Two-component system
Module
bsu_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU37250 (narI)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU37250 (narI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU37250 (narI)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     BSU37250 (narI)
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     BSU37250 (narI)
Transporters [BR:bsu02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   BSU37250 (narI)
SSDB
Motif
Pfam: Nitrate_red_gam Ni_hydr_CYTB
Other DBs
NCBI-GeneID: 938454
NCBI-ProteinID: NP_391606
Pasteur: BG11084
BSORF: BG11084
UniProt: P42177 A0A6M3ZH23
Position
complement(3823558..3824229)
AA seq 223 aa
MSGQILWGIMPYIVLTIFIGGHIYRYQHDQFGWTAKSSELLEKKKLAAGSTLFHWGLLCV
VGGHVMGILIPEGVYASLGISEHMYHKMAIGAGLPAGIAACTGLVILTYRRLFDKRIRKT
SSPSDILTLLLLLFMMLSGVAATFLNIDSKGFDYRTTVGPWFREIVLFRPDASLMESVPL
WFKFHIVIGYVVFILWPFTRLVHVFSLPLKYLTRSYVVYRKRS
NT seq 672 nt   +upstreamnt  +downstreamnt
atgagcgggcagatcctctggggtattatgccatacattgtattgacaatctttatcggc
ggccatatttaccgctatcagcatgaccaatttggctggacggcgaaatcaagcgagctg
ttagaaaagaaaaaacttgcggctggcagcacactttttcactggggactgctgtgcgtt
gtcggcgggcatgtcatggggattctgatcccagaaggcgtgtatgcttcccttggcatt
tcagagcatatgtatcacaaaatggcgattggcgctggcttgccggcgggcattgcggca
tgtaccggacttgtcatcctgacgtacagaaggctgtttgacaaaagaatccgcaaaacg
agctcgccatccgatatccttacgctcctcctgctgctgttcatgatgctgtcaggcgtt
gcggccacgtttctcaacattgattcgaaaggatttgattaccggaccacagtcgggccc
tggttcagggaaatcgttttgttcaggcctgacgcctctttgatggagagtgtcccgcta
tggtttaagtttcatattgtgataggatacgtcgtttttatcctgtggccgtttacgaga
ttggttcatgtgttcagtctgccgctcaagtatctgacccgcagctacgttgtatatcgg
aaacgctcgtga

DBGET integrated database retrieval system