KEGG   Bacillus subtilis subsp. subtilis 168: BSU37260
Entry
BSU37260          CDS       T00010                                 

Symbol
narJ
Name
(RefSeq) nitrate reductase molybdenum cofactor assembly chaperone NarJ
  KO
K00373  nitrate reductase molybdenum cofactor assembly chaperone NarJ/NarW
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU37260 (narJ)
SSDB
Motif
Pfam: Nitrate_red_del
Other DBs
NCBI-GeneID: 937051
NCBI-ProteinID: NP_391607
Pasteur: BG11083
BSORF: BG11083
UniProt: P42178
Position
complement(3824226..3824780)
AA seq 184 aa
MNTTDRQITFSALSCLLSYPDEEWRAELPDWKALIQEIGNRQIREKLLHFFETSASYSPE
ALIEHYVYTFDFGKKTNMYVTYFNSGEQRERGIELLHLKNTYEQSGFLPTEKELPDYLPL
MLEFAAAAEIEAARSVFEKYLSNVRELASRLEKNDSIYAELLHVLLAALENIGVRESVEG
AVQA
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaacaccacagaccggcaaatcacgttctctgctctttcctgtcttctctcttatccg
gatgaagagtggagagccgagcttcccgattggaaggctcttatccaagaaatcggcaac
cggcaaatccgggagaagctgctgcactttttcgagacgtcagccagctattctccggaa
gcgctgattgaacactatgtctatacattcgacttcgggaaaaaaacaaatatgtatgtc
acctactttaactcaggcgagcaaagggaacgcggcattgaattgctgcatttaaaaaac
acatacgagcaatccggtttcctgccgacagagaaagagctgcctgattatctgccgctg
atgctggaatttgctgcggctgcagaaattgaagcagcgagaagcgtgtttgagaaatat
ctgtccaatgtgagggagctggcatcccgtctcgaaaaaaatgacagtatatacgctgaa
ctgctgcacgtgctgctggccgcgcttgaaaacattggcgtacgtgaaagcgttgaaggg
gctgttcaggcatga

DBGET integrated database retrieval system