KEGG   Bacillus subtilis subsp. subtilis 168: BSU37270Help
Entry
BSU37270          CDS       T00010                                 

Gene name
narH
Definition
(RefSeq) nitrate reductase beta chain
  KO
K00371  nitrate reductase / nitrite oxidoreductase, beta subunit [EC:1.7.5.1 1.7.99.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu02020  Two-component system
Module
bsu_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU37270 (narH)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU37270 (narH)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     BSU37270 (narH)
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     BSU37270 (narH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Nitr_red_bet_C Fer4_10 Fer4_7 Fer4_6 Fer4_9 Fer4_2 Fer4 Fer4_13 Fer4_17 Fer4_8
Motif
Other DBs
NCBI-GeneID: 937047
NCBI-ProteinID: NP_391608
Pasteur: BG11082
BSORF: BG11082
UniProt: P42176
Position
complement(3824806..3826269)
Genome map
AA seq 487 aa AA seqDB search
MKIKAQIGMVMNLDKCIGCHTCSVTCKNTWTNRSGAEYMYFNNVETKPGIGYPKQWEDQD
KYKGGWTLKKGKLELKSGSKTNRLAGLFYNPNQPSIDDYYEPWNYDYETLTNSPQKKHQP
VARPKSSLTGDFMNIEWGPNWEDDLAGGHITGLEDPNVQKMEESIKTEFDDVFMMYLPRI
CEHCINPACVSSCPSGAMYKREEDGIVLVDQNACRSWRYCVSSCPYKKVYFNWQTNKAEK
CTLCFPRLEAGLPTICSETCVGRIRYLGVMLYDADKVEEAASVENEKDLYHSQLDVFLDP
NDPEVAKLAKEQGIPAEWIEAAQQSPIYKMIIDWKIALPLHPEYRTLPMVWYIPPLSPIM
NLFEGKGSRQTAEDIFPAIDQMRIPIDYLAQLLTAGDTDHIRSTLKKMSVMRQYMRAVQT
NKSIDPELISSVGLTEQQIEDMYRLLAIAKYDDRFVIPSSHREEVSDLYAEQGSCGLSFS
GGPGSCF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattaaagcgcaaatcggtatggtcatgaacttggataaatgcatcggctgccac
acgtgcagcgtcacctgcaaaaacacgtggacaaaccgttccggtgcggaatatatgtac
ttcaataatgtagaaacaaagccgggcatcggctacccgaagcaatgggaggaccaggac
aaatataaaggcggctggacattgaaaaaaggaaagctcgagctgaaatcgggctcgaaa
accaatcggcttgcaggccttttctataatccgaatcagccgtcaattgatgattactat
gaaccttggaactatgattatgaaacattaacgaacagcccgcagaaaaaacaccagccg
gtagcacgcccgaaatcgtccttgacgggggatttcatgaatatcgaatggggaccgaac
tgggaggacgatctcgcaggcggccacattacgggacttgaagatcccaacgtacaaaag
atggaggaatcgatcaaaacagaattcgatgacgtctttatgatgtatttgccccgtatt
tgcgagcactgcatcaacccggcatgcgtctcatcctgtccatccggcgccatgtacaaa
cgcgaggaggacggcattgtgcttgtggatcaaaacgcatgccgttcatggagatattgc
gtctcatcctgtccttataaaaaagtctattttaactggcaaacgaacaaagcggaaaaa
tgcacactctgctttccgcgtttggaggcgggactgccaaccatctgctctgagacgtgt
gttggcagaatccgctacctcggcgtcatgctatatgacgcggacaaagtggaggaagcg
gcatctgttgaaaatgaaaaggatctctaccattcccaattggacgtttttcttgatccg
aatgatcctgaggttgccaaactggcaaaagaacaaggcattccggctgaatggatagag
gccgcgcagcaatcaccgatctataaaatgatcattgactggaagatcgcgctgccgctt
catcctgagtaccgcacgctgccaatggtgtggtacattccgccgctcagcccgattatg
aatctctttgaaggaaaaggcagccggcaaacggcggaagatatttttccggctatcgac
caaatgagaatcccgatagattatttggcgcagctgttaacagccggtgatacggatcat
attcggtcaacattaaagaaaatgtctgtcatgcgccagtatatgagagcggtccagacg
aataaatcaatcgatccggaactgatctccagtgtcggcttaacagaacagcaaattgaa
gatatgtatcggctgcttgcgattgccaaatatgatgaccgctttgtgattccgagcagc
catcgagaagaagtatcagatttatacgctgaacaaggaagctgcggcttatcattttca
ggcggccccggctcctgtttctaa

DBGET integrated database retrieval system