KEGG   Bacillus subtilis subsp. subtilis 168: BSU37300
Entry
BSU37300          CDS       T00010                                 

Symbol
ywiC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YwiC
Other DBs
NCBI-GeneID: 937048
NCBI-ProteinID: NP_391611
Pasteur: BG11344
BSORF: BG11344
UniProt: P46909 A0A6M4JQA0
Position
3830761..3831480
AA seq 239 aa
MKALIPKQHGAWAMLLIPFLLGMVKGGPVIWHIPLFLGWLFLYLAVYPVTLALKKKQSKP
YQKWMCYYGFPTCCFLMISVFHKPPLIWVGVSLLPLFLIHMYFARRKNERALLNDVAGVL
FFCSGGFASCWLGMGTLDGWAWFIFLQSALFFIGSSFYVKSVIRERKNRAFAYWSWGYHL
LLPFLSALFGAGWAFLAFIPSSLRAWFFHGRDWPVKTIGILEIVNACFFLAVMCLFITR
NT seq 720 nt   +upstreamnt  +downstreamnt
atgaaggcgctgattccgaagcagcacggggcgtgggcgatgctgctgatcccattttta
ctcggcatggtcaagggaggccccgttatttggcatattccgctcttccttggttggctt
ttcctatacttagcggtttatcccgttacgcttgccttaaaaaagaaacaaagcaaacca
tatcaaaagtggatgtgttattacggttttcccacctgctgctttttgatgatctcggtc
tttcataagccgcctctcatctgggtgggcgtttctttactgccgctgtttctcatacat
atgtattttgcccgcagaaaaaacgaacgagccttattgaatgatgttgcaggtgtcttg
ttcttttgttcgggcgggtttgcgagctgctggctggggatgggaacccttgacggctgg
gcttggtttattttcttgcagtctgctttattttttatcgggagttccttttatgtgaaa
tcggtgatccgcgagagaaaaaacagggcatttgcatactggtcatggggatatcacctg
ctgctcccctttttatccgctcttttcggagcaggatgggcgtttctcgcttttatcccg
agcagcttgcgggcatggttttttcatggaagggattggcccgtaaaaacgattggcatt
ctggaaatcgtgaatgcctgcttctttcttgccgtcatgtgcctgtttatcacaaggtaa

DBGET integrated database retrieval system