KEGG   Bacillus subtilis subsp. subtilis 168: BSU37310
Entry
BSU37310          CDS       T00010                                 

Symbol
fnr
Name
(RefSeq) anaerobic regulatory protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: cNMP_binding Crp HTH_Crp_2 HTH_24 Phage_rep_O
Other DBs
NCBI-GeneID: 937050
NCBI-ProteinID: NP_391612
Pasteur: BG11343
BSORF: BG11343
UniProt: P46908 A0A6M3ZLE7
Position
complement(3831512..3832228)
AA seq 238 aa
MNFLSVRPSDSDLISSDLYELLESISTKRKMEKHTYLFREGMDAEELYLIQSGLIEIGKL
TSDGKDLTLRICQKHDIVGELTLFTEEPRYMLSAKVLEDGEVLVINKNKLEKELIQNGAL
TFEFMKWMSTHLRKIQSKIRDLLLHGKKGALYSTLIRLSNSYGVERSDGILINIVLTNQD
LAKFCAAARESVNRMLGDLRKKGVISIDESGKIILHKRDYLRCEIECENCPLEICNID
NT seq 717 nt   +upstreamnt  +downstreamnt
atgaattttctctctgttcgaccatctgatagtgatcttatatccagcgatctgtatgaa
ttgctggaatcgatcagcacgaaaagaaaaatggaaaaacacacgtatttgtttcgggaa
ggaatggatgcagaagagctttatctgattcaatcaggactcattgaaatcggcaagctg
acatctgacggaaaagacctgacgcttagaatctgccaaaagcatgatatcgtcggagaa
ttaacacttttcactgaagaaccaaggtatatgctcagtgcaaaagtactagaggatggc
gaggtgctcgtcattaataaaaataagctggaaaaagaattaatccaaaacggcgctttg
acatttgagttcatgaaatggatgagcacgcacctccggaagattcagtccaaaatcagg
gatctgcttcttcatggcaaaaagggggcgctctattctacccttatccgcttatcaaac
agctacggagtggagcgaagcgacggcattctgattaacattgtcctgacaaatcaggat
ttggcaaagttttgcgcggctgcacgggaaagcgtcaatcgtatgctcggagatctccgc
aaaaaaggggttatttcgatagacgaatccggaaaaattattttgcacaagcgggactat
ttacgatgtgagattgagtgtgaaaattgcccgctggagatttgcaatattgactga

DBGET integrated database retrieval system