KEGG   Bacillus subtilis subsp. subtilis 168: BSU37340
Entry
BSU37340          CDS       T00010                                 

Symbol
ywiB
Name
(RefSeq) beta-barrel protein YwiB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1934 PH_11 DUF3952
Other DBs
NCBI-GeneID: 937056
NCBI-ProteinID: NP_391615
Pasteur: BG14161
BSORF: BG14161
UniProt: O07624 A0A6M4JQ69
Structure
PDB: 
1R0U

Position
complement(3835317..3835745)
AA seq 142 aa
MKQETPITLHVKSVIEDDGNQEVIEFRTTGFYYVKQNKVYLSYYEEHDLGKVKTIVKVSE
GEVLVMRSGAVKMNQRFVTGASTIAKYKMSFGELELKTSTKSIQSDLDEEKGRISIAYDM
HVGDEQEHLHNMTITYEGGTHA
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaagcaagagacaccgataacactccatgtgaagtctgtgatcgaggatgacggaaac
caagaagtcatcgaattccgcaccaccggattttactatgtaaaacaaaataaagtgtat
ctatcttattatgaagaacacgacttaggcaaagtcaaaacgattgtgaaagtaagcgaa
ggcgaagtcctggtcatgaggtcaggcgctgtcaaaatgaatcagcgtttcgtaacggga
gcttccacaattgctaaatataaaatgtcatttggtgagcttgagctgaaaacaagcaca
aaatcgattcaatctgatctcgatgaagaaaaaggccgtatcagcatcgcatatgacatg
catgtcggagacgagcaggagcatttacataatatgacgatcacgtatgagggaggaact
cacgcatga

DBGET integrated database retrieval system