KEGG   Bacillus subtilis subsp. subtilis 168: BSU37350Help
Entry
BSU37350          CDS       T00010                                 

Gene name
sboA
Definition
(RefSeq) subtilosin-A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Subtilosin_A
Motif
Other DBs
NCBI-GeneID: 938512
NCBI-ProteinID: NP_391616
Pasteur: BG12671
BSORF: BG12671
UniProt: O07623
Position
3836058..3836189
Genome map
AA seq 43 aa AA seqDB search
MKKAVIVENKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagctgtcattgtagaaaacaaaggttgtgcaacatgctcgatcggagccgct
tgtctagtggacggtcctatccctgattttgaaattgccggtgcaacaggtctattcggt
ctatgggggtaa

DBGET integrated database retrieval system