KEGG   Bacillus subtilis subsp. subtilis 168: BSU37360
Entry
BSU37360          CDS       T00010                                 

Gene name
sboX
Definition
(RefSeq) bacteriocin-like protein SboX
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Other DBs
NCBI-GeneID: 2914193
NCBI-ProteinID: YP_054594
Pasteur: BG14182
BSORF: BG14182
UniProt: Q7WY57 A0A6M3ZH32
Position
3836146..3836298
AA seq 50 aa
MKLPVQQVYSVYGGKDLPKGHSHSTMPFLSKLQFLTKIYLLDIHTQPFFI
NT seq 153 nt   +upstreamnt  +downstreamnt
ttgaaattgccggtgcaacaggtctattcggtctatgggggtaaggatctcccaaaaggg
catagtcattctactatgccctttttaagtaaattacaatttttaactaaaatctacctc
ttggatatacatacacaaccgtttttcatttga

DBGET integrated database retrieval system