KEGG   Bacillus subtilis subsp. subtilis 168: BSU37370
Entry
BSU37370          CDS       T00010                                 

Symbol
albA
Name
(RefSeq) antilisterial bacteriocin subtilosin biosynthesis protein AlbA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Radical_SAM SPASM PqqD Fer4_14 Fer4_12
Other DBs
NCBI-GeneID: 937059
NCBI-ProteinID: NP_391617
Pasteur: BG12471
BSORF: BG12471
UniProt: P71011 A0A6M3ZHF4
Position
3836323..3837669
AA seq 448 aa
MFIEQMFPFINESVRVHQLPEGGVLEIDYLRDNVSISDFEYLDLNKTAYELCMRMDGQKT
AEQILAEQCAVYDESPEDHKDWYYDMLNMLQNKQVIQLGNRASRHTITTSGSNEFPMPLH
ATFELTHRCNLKCAHCYLESSPEALGTVSIEQFKKTADMLFDNGVLTCEITGGEIFVHPN
ANEILDYVCKKFKKVAVLTNGTLMRKESLELLKTYKQKIIVGISLDSVNSEVHDSFRGRK
GSFAQTCKTIKLLSDHGIFVRVAMSVFEKNMWEIHDMAQKVRDLGAKAFSYNWVDDFGRG
RDIVHPTKDAEQHRKFMEYEQHVIDEFKDLIPIIPYERKRAANCGAGWKSIVISPFGEVR
PCALFPKEFSLGNIFHDSYESIFNSPLVHKLWQAQAPRFSEHCMKDKCPFSGYCGGCYLK
GLNSNKYHRKNICSWAKNEQLEDVVQLI
NT seq 1347 nt   +upstreamnt  +downstreamnt
ttgtttatagagcagatgtttccatttattaatgaaagtgtaagagttcaccagcttcct
gagggcggcgtgttagaaatcgactacttgcgcgataatgtctccatttctgactttgag
tatttggatctcaacaaaacggcttacgagctctgcatgcgcatggatggccaaaaaaca
gctgagcagattttagctgagcaatgtgcagtgtatgatgaatcaccggaagaccataaa
gattggtattacgacatgctcaacatgctccagaacaagcaggttattcagcttggaaac
cgggccagccgccatacaatcaccacgagcggaagcaatgaatttccgatgcccctgcac
gccacctttgaactgacgcaccgctgtaatttgaaatgcgcccactgttatttggaaagc
tcacctgaagcgctcggcaccgtgtcgattgagcaattcaaaaaaacggctgatatgctg
tttgataacggtgtattgacatgcgaaatcacaggtggagaaatttttgtccatccaaac
gccaatgagattcttgactatgtgtgtaaaaagttcaaaaaagtcgctgtcttaacaaac
ggaacactcatgcgaaaagagagcctggagcttttgaagacttacaagcaaaaaatcatc
gtcggcatttctctagatagtgtcaattccgaggtccatgactcctttagagggagaaaa
ggctcttttgcccaaacttgtaaaacgataaaattgttgagtgaccacggtatatttgtc
agagtcgctatgtctgtcttcgaaaaaaacatgtgggaaatccacgatatggcccaaaag
gttcgggatctcggggcgaaggcgttttcttacaattgggttgacgatttcggaagaggc
agggatattgtccatccaacgaaagacgccgagcagcaccgcaagtttatggaatacgag
caacatgtgattgatgagtttaaagatctgattccgattattccctatgagagaaaacgc
gcggcaaattgcggcgctggctggaagtccattgtgatcagtccgttcggcgaagtacgt
ccttgcgccctctttccaaaggaattttcattgggaaatatttttcatgattcctatgaa
agcatctttaactcccctctcgtccataaactgtggcaagcgcaagcgccgcggttcagc
gaacattgcatgaaagacaaatgcccgttcagcggctattgcggaggctgttacttaaaa
gggctgaactctaacaaatatcaccggaaaaacatttgctcttgggcgaaaaatgaacaa
ttagaagacgtggtccagcttatttag

DBGET integrated database retrieval system