KEGG   Bacillus subtilis subsp. subtilis 168: BSU37380
Entry
BSU37380          CDS       T00010                                 

Gene name
albB
Definition
(RefSeq) antilisterial bacteriocin subtilosin biosynthesis protein AlbB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: YrhK CNDH2_N DUF5699
Other DBs
NCBI-GeneID: 937057
NCBI-ProteinID: NP_391618
Pasteur: BG12470
BSORF: BG12470
UniProt: P71010 A0A6M3ZHA3
Position
3837682..3837843
AA seq 53 aa
MSPAQRRILLYILSFIFVIGAVVYFVKSDYLFTLIFIAIAILFGMRARKADSR
NT seq 162 nt   +upstreamnt  +downstreamnt
ttgtcaccagcacaaagaagaattttactgtatatcctttcatttatctttgtcatcggc
gcagtcgtctattttgtcaaaagcgattatctgtttacgctgattttcattgccattgcc
attctgttcgggatgcgcgcgcggaaggctgactcgcgatga

DBGET integrated database retrieval system