KEGG   Bacillus subtilis subsp. subtilis 168: BSU37390
Entry
BSU37390          CDS       T00010                                 

Symbol
albC
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU37390 (albC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU37390 (albC)
SSDB
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase MMR_HSR1 AAA_23 AAA_13 FeoB_N CTI AAA_29 cobW AAA_16 MeaB DLIC SRP54
Other DBs
NCBI-GeneID: 937068
NCBI-ProteinID: NP_391619
Pasteur: BG12469
BSORF: BG12469
UniProt: P71009 A0A6M3ZK31
Position
3837840..3838559
AA seq 239 aa
MSILDIHDVSVWYERDNVILEQVDLHLEKGAVYGLLGVNGAGKTTLINTLTGVNRNFSGR
FTLCGIEAEAGMPQKTSDQLKTHRYFAADYPLLFTEITAKDYVSFVHSLYQKDFSEQQFA
SLAEAFHFSKYINRRISELSLGNRQKVVLMTGLLLRAPLFILDEPLVGLDVESIEVFYQK
MREYCEAGGTILFSSHLLDVVQRFCDYAAILHNKQIQKVIPIGEETDLRREFFEVIGHE
NT seq 720 nt   +upstreamnt  +downstreamnt
atgagcattttggatatacacgatgtatccgtttggtatgaacgggacaacgtcatctta
gaacaagtggatttacatttagaaaaaggcgccgtttacgggttacttggggtaaacggc
gccggaaaaacgacactgattaatacgctgacaggcgtgaaccgcaatttcagcgggcgt
tttacactgtgcggaattgaagcggaggccggcatgccgcagaaaacatcagatcagctg
aagactcaccgttacttcgccgccgattatccgctgctatttacagaaattacggcgaag
gactatgtgtctttcgtccattcgctttatcaaaaggatttttcagagcagcagtttgcc
agtttggccgaggcctttcatttttcgaaatacatcaataggagaatttcggagctgtcc
ttggggaacaggcaaaaggttgtattgatgacaggcttattgctgcgcgctcccctgttt
attttggatgagccgctcgtcggtttggatgtggaatcgatagaggtcttttatcagaaa
atgcgtgagtactgtgaagcaggcggaaccattttgttttcttctcatctgctcgatgtc
gtgcaaagattttgtgattatgcggctattcttcacaacaaacagatccaaaaggtcatt
ccgattggagaggagaccgatctgcggcgggaatttttcgaggtgatcggccatgaataa

DBGET integrated database retrieval system