KEGG   Bacillus subtilis subsp. subtilis 168: BSU37400
Entry
BSU37400          CDS       T00010                                 

Symbol
albD
Name
(RefSeq) antilisterial bacteriocin subtilosin biosynthesis protein AlbD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937053
NCBI-ProteinID: NP_391620
Pasteur: BG12468
BSORF: BG12468
UniProt: P71008 A0A6M4JQB0
Position
3838552..3839862
AA seq 436 aa
MNNIIPIMSLLFKQLYSRQGKKDAIRIAAGLVILAVFEIGLIRQAGIDESVLRKTYIILA
LLLMNTYMVFLSVTSQWKESYMKLSCLLPISSRSFWLAQSVVLFVDTCLRRTLFFFILPL
FLFGNGTLSGAQTLFWLGRFSFFTVYSIIFGVVLSNHFVKKKNLMFLLHAAIFACVCISA
ALMPAATIPLCAVHILWAVVIDFPVFLQAPPQQGKMHSFMRRSEFSFYKREWNRFISSKA
MLLNYAVMAVFSGFFSFQMMNTGIFNQQVIYIVISALLLICSPIALLYSIEKNDRMLLIT
LPIKRKTMFWAKYRFYSGLLAGGFLLVVMIVGFISGRSISVLTFLQCIELLLAGAYIRLT
ADEKRPSFSWQTEQQLWSGFSKYRSYLFCLPLFLAILAGTAVSLAVIPIAGLVIVYYLQK
QDGGFFDTSKRERLGS
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgaataacataatccctatcatgtctttgctgttcaaacagctttacagccggcaaggg
aaaaaggacgccatccgcattgccgcaggccttgtcattctggccgtgtttgaaatcggg
ctgatccgccaggccggcattgatgaatcggtgttgcgcaaaacgtatatcatactcgcg
cttcttttgatgaacacatatatggtgtttctttccgtgacatcacaatggaaggaatct
tatatgaagctgagctgcctgctgccgatttcttcacggagcttttggctcgcccagagt
gtcgttttgtttgtcgatacctgtttgagaagaactttattcttttttattttaccgctg
ttcttatttggaaacggaacgctgtcaggggcgcaaacattgttttggctcggcaggttt
tcgttttttaccgtttactccattattttcggagttgtgctaagcaaccacttcgtcaaa
aagaagaacttgatgtttctgctgcatgcggcgatattcgcctgtgtatgtatcagcgcc
gctttgatgccggccgccacgattccgctttgcgcggttcatatcctgtgggcggtggtc
attgactttcctgtctttctgcaggcgcctccgcagcagggcaagatgcattcatttatg
cggcgatctgaattttcgttttacaaaagagaatggaaccgatttatctcttctaaagcg
atgctgttaaattacgcggtaatggcggtattcagcggcttcttttcgttccagatgatg
aacaccggcatcttcaatcagcaagtgatttatatcgtgatttccgcgcttttgctcatc
tgctcgccgatcgcccttttgtattcgattgaaaaaaatgaccggatgctgctcatcacg
cttccgatcaagcgaaaaacgatgttttgggcgaaatatcgcttttattcaggcctattg
gcaggcggatttctccttgtcgtgatgattgtgggtttcatcagcggccgttcgatttca
gttctcacttttttgcagtgcattgagttgctgctggcgggagcgtatatcaggttaact
gcggatgaaaaaaggccctccttcagctggcagacggagcagcagctatggagcggtttc
tcaaaatatcggtcttatctgttttgtcttcccctattcttagccatattagccggcacc
gctgtatccttggcggtcattccgatagccggtctggtcatagtctattacctgcaaaaa
caggatggtggtttctttgatacaagcaaaagagaacggcttggaagttaa

DBGET integrated database retrieval system