KEGG   Bacillus subtilis subsp. subtilis 168: BSU37410
Entry
BSU37410          CDS       T00010                                 

Symbol
albE
Name
(RefSeq) antilisterial bacteriocin subtilosin biosynthesis protein AlbE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_M16_C
Other DBs
NCBI-GeneID: 938514
NCBI-ProteinID: NP_391621
Pasteur: BG12467
BSORF: BG12467
UniProt: P71007 A0A6M3ZMB6
Position
3839852..3841012
AA seq 386 aa
MEVNLLKTHQFSTISIAASFLKPIESAAEPEEETIYFYGAAAYLKEQIIDAFGYAAGSRF
MYSANLFFDQQLKTCGTRLIHPLYNGNLHVDALMKTFADLSFPSSLSFEAFEKARNELLL
KIEKKFTDPFSYSAARLAEEVFGNPMYGTGMFGRRDRIKAIHPKRFLDATDFIVDLVSQQ
KQLNILGQVQACDVRGHAPQTSAVTSGRIPVNRHVFETETRSAAGPSVLTLGFDCGEMKD
ASDYIKIQLIDGLLGKYGHSALFKHFREKDLAVYHVITRYDVMNNLLLVSICTDQLHEKD
IPPRVLEAVSAFHTDERELEQAKQFLRNELLLQFDSPEGLLAYMGVLRRFSCTKEALLDG
ISAVTCRDVLQFIATINYIGAHVVRG
NT seq 1161 nt   +upstreamnt  +downstreamnt
ttggaagttaacctgctgaagactcatcaattttcaactatttcaatcgccgcgagcttt
ctgaaaccgatcgaaagcgcggcggaacctgaggaagaaacgatttatttttacggcgcc
gccgcatacctgaaggagcaaatcattgacgcttttggttatgctgccggcagccgtttc
atgtactcagcgaatctcttttttgatcagcagctgaaaacctgcgggacccgtttgatt
cacccattatataacgggaatcttcatgttgacgccctgatgaaaacttttgcagacttg
tctttcccttcttctctttcattcgaagcatttgaaaaggccaggaatgagctgctgctg
aaaatcgaaaagaaattcactgatcccttctcctactcggcggctcgcttggctgaggag
gtcttcggaaacccgatgtacggcacaggcatgtttggccggagagacaggataaaggcg
attcatcctaaacggtttctcgacgcaacggactttatcgttgatttagtgtcccagcaa
aaacagctgaacatattgggacaagtacaagcatgtgatgttcggggacatgccccgcaa
acgtccgctgtaacgtccggaagaatacccgtaaaccggcatgtttttgaaacagagaca
cgcagcgctgcaggtccttccgtcttgacactcggatttgactgcggagagatgaaagat
gccagcgattatatcaaaatacagctaatagacggattactgggaaagtacggccattcc
gctttattcaagcacttcagagagaaggatctggcagtctatcacgttatcacccgttac
gatgtcatgaacaatttgctgcttgtttcaatatgtacagatcagcttcatgagaaagac
attcccccgcgcgttttggaagctgtctcagcttttcatacagatgagcgggaactagaa
caggcaaagcagtttttacgcaatgaattgctgctgcaattcgattctcccgaaggtcta
ttggcctatatgggggtcctgcgccgcttctcctgcacgaaagaagccttgctggatggc
atctcagcggttacatgccgtgatgtattgcaattcatagcgaccatcaattatatcgga
gctcatgtagtaaggggatga

DBGET integrated database retrieval system