KEGG   Bacillus subtilis subsp. subtilis 168: BSU37420
Entry
BSU37420          CDS       T00010                                 

Gene name
albF
Definition
(RefSeq) zinc protease AlbF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C
Other DBs
NCBI-GeneID: 938515
NCBI-ProteinID: NP_391622
Pasteur: BG12466
BSORF: BG12466
UniProt: P71006 A0A6M4JQ70
Position
3841017..3842297
AA seq 426 aa
MEKKAFFQQLDERTDIRYTDSGLKIFRLKFPRAHLRLCNVKIDFGSRDVCIRAESGDTLL
PYGTAHFLEHLLFWHNGRNLYSDFFAHGALLNAFTTYTDTNFMFTSLPDRLRQTIPILLD
ALWNHSFDKKIVAQEKAVITSEIQTAHLNHQLSYHYQLISMLSPSSPAAVFPAGRIEDIE
ALDISDLQKAYKAAYQAHRMTLFLIGGSENTETLLPPHLQLEKRPDYHAERKIIPACPPV
LSQKMMLGDEERMEDTWTGLQIGALPGQNDLLSIKLYWDIAARILFQLDSPFFQEIQQTY
RLEIDRLSAETYIYEDGGFLILHSQGTHSSAYIDVASYYVTQKKEQVAAWLQYGKDSLTD
AIIYDSDYVRKCFEWAAECDRCDCSFLDMYHIIQDMDAQVFLSLIDAMASSNKAIIHVSQ
KEAIRQ
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggaaaagaaagccttttttcaacagctggatgaacgaaccgatatcagatacacagac
agcggactaaaaatattcagattgaaattcccccgcgcccacctgcggctgtgcaatgta
aaaatcgattttggaagccgggatgtatgtatacgggcagaatccggtgatacactgctt
ccgtatggcacagcacattttttagagcatcttctcttctggcataacggccgcaatctg
tacagtgatttttttgcgcatggcgcgcttttaaacgcattcactacctacaccgatacc
aatttcatgtttacctcattaccggatcggctcagacaaacgattcccatcctgcttgat
gctttatggaaccactcatttgacaagaagattgtcgctcaggaaaaagctgtgattaca
agcgaaattcaaacagcacaccttaaccatcagctctcatatcattatcagctgatcagc
atgctttctccctcctcaccagctgccgttttccccgcaggcagaatcgaagatattgag
gcgctggacatcagtgatttacaaaaagcctataaggctgcctaccaagcccatcggatg
acgctgtttttgattgggggctcagaaaatacagaaacgcttttgcctcctcacctccag
ctggaaaagcgtccggattatcatgctgaaagaaaaatcatcccggcatgccctccagtc
ctctcacaaaaaatgatgctgggtgatgaggagcggatggaagatacctggaccggatta
cagatcggcgcacttcccgggcaaaacgatctgttgtcgataaagctttattgggatatc
gcggctcgtattctatttcaattagattcaccgttttttcaagagattcagcaaacgtac
cgcctggaaatcgatcgcttgtcagccgagacttatatatatgaggatggcggtttcttg
atccttcacagtcaagggacccattcttcagcttatatcgatgtggcttcatactatgtc
acacagaagaaagaacaggttgccgcctggcttcaatacggcaaggactctttgacagac
gcgatcatttatgacagcgattatgtgcgtaaatgcttcgagtgggcagccgagtgtgac
aggtgcgattgctcgtttcttgacatgtaccacatcattcaagatatggatgcgcaggtt
ttcttgtctctcattgatgcaatggcatcttctaacaaagcgatcattcacgtttctcag
aaagaggcgatcagacaatga

DBGET integrated database retrieval system