KEGG   Bacillus subtilis subsp. subtilis 168: BSU37430Help
Entry
BSU37430          CDS       T00010                                 

Gene name
albG
Definition
(RefSeq) antilisterial bacteriocin subtilosin biosynthesis protein AlbG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MscS_TM
Motif
Other DBs
NCBI-GeneID: 937060
NCBI-ProteinID: NP_391623
Pasteur: BG12465
BSORF: BG12465
UniProt: P71005
Position
3842294..3842995
Genome map
AA seq 233 aa AA seqDB search
MKQSTVFTLLLLLIGMAAYSFGWVQAVAEAAAQYVQMINNDAVRLGLLACTAALLMLPAF
LYLHYVTQSVKNMTAAFQKLTQSHQSCCDFQQHNLCSRYAEDVKSLRDSYKNVRQTYVMA
AVLCQVIIFGCMFEIVKAVPFRLHTPPAFSMGLAMLLILYLLFCMRTYLRQLFRHGSLFR
KVFAGALAAAGIWWMLSFSISELLFLIILAAIQQIGSFIYKRFSYHSTASLDL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagcactgtctttacccttttattgctgcttataggtatggcggcttattcc
ttcggctgggttcaggccgttgccgaagccgccgcccaatatgtacagatgatcaacaat
gatgctgtgcggctcggactgctggcttgtaccgctgccctcctgatgctgcctgctttt
ctctatcttcactatgtcacccaatccgtgaaaaacatgacagcagcttttcagaaactc
acacagtctcatcaaagctgctgtgactttcagcaacacaacttgtgcagccgatatgca
gaagacgtcaaatcgctgcgtgacagctataaaaacgtccgccaaacatacgtgatggct
gccgtgttgtgccaagtcatcatattcggctgcatgttcgaaatcgttaaagccgtccct
ttccgccttcatacgccccctgccttttcaatgggacttgcgatgctactgatcctgtat
ttattgttttgcatgcgaacgtatttgcggcagcttttccggcacggcagcctgttcaga
aaagtgtttgcgggagcactggcagcagccgggatttggtggatgctcagtttctctata
agtgaactgctgtttctgattatcctggctgccattcagcaaatcggatcatttatttat
aaacgattctcttatcacagcaccgcttctcttgatctataa

DBGET integrated database retrieval system