KEGG   Bacillus subtilis subsp. subtilis 168: BSU37430
Entry
BSU37430          CDS       T00010                                 

Symbol
albG
Name
(RefSeq) antilisterial bacteriocin subtilosin biosynthesis protein AlbG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF6377 ATG17_like
Other DBs
NCBI-GeneID: 937060
NCBI-ProteinID: NP_391623
Pasteur: BG12465
BSORF: BG12465
UniProt: P71005 A0A6M3ZI63
Position
3842294..3842995
AA seq 233 aa
MKQSTVFTLLLLLIGMAAYSFGWVQAVAEAAAQYVQMINNDAVRLGLLACTAALLMLPAF
LYLHYVTQSVKNMTAAFQKLTQSHQSCCDFQQHNLCSRYAEDVKSLRDSYKNVRQTYVMA
AVLCQVIIFGCMFEIVKAVPFRLHTPPAFSMGLAMLLILYLLFCMRTYLRQLFRHGSLFR
KVFAGALAAAGIWWMLSFSISELLFLIILAAIQQIGSFIYKRFSYHSTASLDL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaaacaaagcactgtctttacccttttattgctgcttataggtatggcggcttattcc
ttcggctgggttcaggccgttgccgaagccgccgcccaatatgtacagatgatcaacaat
gatgctgtgcggctcggactgctggcttgtaccgctgccctcctgatgctgcctgctttt
ctctatcttcactatgtcacccaatccgtgaaaaacatgacagcagcttttcagaaactc
acacagtctcatcaaagctgctgtgactttcagcaacacaacttgtgcagccgatatgca
gaagacgtcaaatcgctgcgtgacagctataaaaacgtccgccaaacatacgtgatggct
gccgtgttgtgccaagtcatcatattcggctgcatgttcgaaatcgttaaagccgtccct
ttccgccttcatacgccccctgccttttcaatgggacttgcgatgctactgatcctgtat
ttattgttttgcatgcgaacgtatttgcggcagcttttccggcacggcagcctgttcaga
aaagtgtttgcgggagcactggcagcagccgggatttggtggatgctcagtttctctata
agtgaactgctgtttctgattatcctggctgccattcagcaaatcggatcatttatttat
aaacgattctcttatcacagcaccgcttctcttgatctataa

DBGET integrated database retrieval system