KEGG   Bacillus subtilis subsp. subtilis 168: BSU37440
Entry
BSU37440          CDS       T00010                                 

Gene name
ywhL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: Lactonase RuvB_C
Other DBs
NCBI-GeneID: 937067
NCBI-ProteinID: NP_391624
Pasteur: BG12464
BSORF: BG12464
UniProt: P71004 A0A6M4JQB8
Position
complement(3843001..3844377)
AA seq 458 aa
MKKNDLSALQENCFCFCDEEISREAPFQVPIDFPEGFKVDTAEASAAVTWSTDNLSCISE
PCLIQTGPEPEDIGVRYAVRVQGTITLLVSVSPVRNQYGQGDGAVSVIHTEEIDQVVYYA
AQSGRCPDFSQITVEDLLIVPPFYGSPLTVAGTLVLPPSPDPQSYVFTANTGDSTVSVID
ADLNTVVKTIPFSDVPTNLGVTFDKAFTYVLHGNTNLVSVIDNKTLTIINTITVGGGPRK
IEFDPTDEFAYVMAAGSIYVINTASQSVIDVIPIPGALDFALDPNGQYVYTANGSSWSVD
KYDVNTGQLVESIIDTFEFPSLITTPYAGNFAYVLNGELWPKGVTEISLSPLSRGGDFSR
LFETLRTIVFSLDSTRAYFLEPYSEPFLINNLYVVNTARQRIIANVSLPGAFDLAVTPDK
QYIYAAQPNDNAVTVYRTSDYTAVTVIPVGAGPSAIAM
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaaaaagaatgatctttctgctttacaggaaaattgtttctgtttttgtgatgaggaa
attagccgggaagcgccgtttcaagtgccgatagatttccctgagggcttcaaggttgat
acggccgaagcgtcagcggctgttacatggagtacagacaatttgtcctgtatcagtgag
ccttgcttaatccagactgggccggaaccagaagatatcggtgttcgatatgctgtgaga
gtacaagggaccattacgcttcttgtcagtgtgtcgcctgtacgaaatcaatatggacaa
ggagacggggctgtttctgtgattcatactgaagagattgatcaagttgtttattatgca
gcacagtctggccgctgtcctgatttcagtcaaataacagtggaagatctgctcattgta
ccgcctttctacggcagtccgcttacggtggccgggacacttgttttaccgccatcacca
gaccctcaatcgtatgtgtttactgccaatactggagacagcacggtttcggttattgat
gcagatttaaacactgttgtaaaaacaatccctttttctgacgtgccaactaatctaggc
gttactttcgataaagcattcacgtatgtcctccatggaaataccaaccttgtctcagtg
attgataataaaacattaaccatcataaataccattactgttggaggagggccgagaaaa
atcgaatttgatccaacagatgagttcgcatacgtgatggccgccggatctatatatgtg
attaacacggcctctcaatcggtcattgatgtcattccgatacccggcgctttagacttt
gctcttgatccgaatggacagtatgtctataccgctaatggaagcagttggtcggttgat
aaatatgatgtaaatactgggcagttggtagaaagtatcatagatacatttgaatttccc
agtttaattacaactccttacgctggaaattttgcgtacgtattgaatggtgagctgtgg
ccgaaaggtgtaacggagattagtttgtcaccattaagcaggggaggggacttcagccgt
ttatttgaaacgctgaggacgattgtattttctctcgatagtactagagcttattttcta
gagccatatagtgaaccgtttctcattaataacttatacgtagttaatacggccagacag
aggatcattgcaaacgtgtctctccccggcgcctttgacctcgccgtaacgccggacaaa
cagtatatttatgcggcacagcccaacgacaatgctgtgaccgtgtaccgcacaagtgat
tatacagccgtgacggtgattccggttggcgcgggtccgtctgcgattgcgatgtag

DBGET integrated database retrieval system