KEGG   Bacillus subtilis subsp. subtilis 168: BSU37450
Entry
BSU37450          CDS       T00010                                 

Symbol
ywhK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Cytochrom_D1
Other DBs
NCBI-GeneID: 937087
NCBI-ProteinID: NP_391625
Pasteur: BG12463
BSORF: BG12463
UniProt: P71003 A0A6M3ZHI7
Position
complement(3844416..3845771)
AA seq 451 aa
MRKNKLSFKEKAGAEQEECLCFCEGEASREAMFQAPIELPEGFVVDPAEAVANVTWNADS
LSCVSDRCLIQTGPEPDEVGVQFAVRLQGTVTLLVSVSPVRNQYGQGDGAVSVIHNAEID
QVVYYSDESDDCPDISDITIENLVVVPPFYGSPLSVTGTIVLVPEPEPVYAFTANPNDQS
VSVIDTNTDTVVTTIALPYNPAGIEITPDKSAVFVLHPNNNVISVIDYDTLTVTATILLD
QPPRLIRFIPNHEFAYVFTGTAVYVIGIDTLTVDRSIPVEGYDVAIDPNGLFAYVLNFGI
VQKVDLTTGEVTGTIERELIVSTIETNWPERYAYVLEQEFFFNYLTVIDLNTFTISSTQE
LEYEGEYRMFTSGAEVYLYDGFTGNLYSVSPNGAGVIGNVPQSATDYAFTPNGDFLYATR
FIEQSIIVYNTDDYSEETVISLGVSPGAITI
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgagaaaaaacaagctttcctttaaagaaaaagcaggagcagaacaagaagagtgctta
tgtttttgtgagggagaagcaagccgagaagccatgtttcaagcaccgattgaattacct
gaagggtttgtcgttgatccggctgaagctgttgcaaacgtgacgtggaatgcagacagc
ctttcttgtgtcagtgaccgttgcttaattcaaacggggcctgagcctgatgaggtcggt
gttcaatttgcagtgcgcctgcagggaaccgttacgctactcgtcagtgtctcacctgtc
cgaaatcaatatggacaaggggacggggctgtttccgtcattcacaatgcagaaatcgat
caagtcgtctattattccgatgaatcggatgattgcccggatatcagtgacatcacgatt
gagaaccttgttgttgttccgccgttttacggcagtcctttatcggtgacggggacaatt
gtgcttgtaccggagccggaacccgtctacgcgtttacagcgaatccaaatgatcaatca
gtttctgtgattgatacaaacaccgatactgttgtgacaacgattgctcttccgtacaat
ccggcaggtattgaaattacgccagataaaagcgctgtgtttgtcttacatcccaacaat
aatgtgatttctgtcatcgattatgacacattaacagtgacagcaactatattgctggat
cagccgcctcgattgattagatttatccctaatcatgagtttgcttatgttttcaccggt
actgcggtttatgtgattggaattgatacgttaactgtggataggtcgattcctgtggaa
ggatatgatgttgcaatcgatcccaatgggttattcgcctatgttctgaattttggaata
gtgcaaaaagtggacctaactaccggtgaagtcacaggaacaattgaacgagagcttatc
gtatcaaccatagaaacaaattggccggagcggtatgcctatgtattagaacaagaattc
ttttttaattatttgacggttattgatttaaatacgtttaccatcagcagcacccaagag
ctggagtatgaaggggaatatcgaatgtttacgagtggagcagaggtgtatttatatgac
ggcttcactggcaatttatattctgtcagtccaaatggagcaggcgttataggaaatgtt
ccgcaatcagcaacagactatgcgtttaccccgaatggcgattttctgtatgcaactcgt
tttatagagcagagcatcattgtttacaacacagatgattattctgaggaaactgtgata
tctcttggggtttcaccgggtgccattacgatttaa

DBGET integrated database retrieval system