KEGG   Bacillus subtilis subsp. subtilis 168: BSU37470
Entry
BSU37470          CDS       T00010                                 

Symbol
phrF
Name
(RefSeq) phosphatase RapF inhibitor
  KO
K06355  phosphatase RapF regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU37470 (phrF)
SSDB
Motif
Pfam: PhrC_PhrF
Other DBs
NCBI-GeneID: 936721
NCBI-ProteinID: NP_391627
Pasteur: BG11960
BSORF: BG11960
UniProt: P71001 A0A6M4JQA5
Position
3847130..3847249
AA seq 39 aa
MKLKSKLLLSCLALSTVFVATTIANAPTHQIEVAQRGMI
NT seq 120 nt   +upstreamnt  +downstreamnt
atgaaattgaagtctaaactattactctcttgtctggctctaagcactgtgttcgtggca
acaactattgcaaatgcacctacacaccaaattgaagttgcacaacgaggaatgatttaa

DBGET integrated database retrieval system