KEGG   Bacillus subtilis subsp. subtilis 168: BSU37480
Entry
BSU37480          CDS       T00010                                 

Symbol
ywhH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: tRNA_edit zf-CHC2
Other DBs
NCBI-GeneID: 937183
NCBI-ProteinID: NP_391628
Pasteur: BG12462
BSORF: BG12462
UniProt: P71000 A0A6M4JQ80
Position
3847348..3847821
AA seq 157 aa
MSLKSVRTHFTQWNRENDVTEFETSSATVEQAAETIGVSLSRIAKSLSFRGEGDQVILIV
AAGDAKIDNKKSRQTFGFKARMLSPNEVLEQTGHEIGGVCPFGLAHDPEVYLDVSLKRFQ
TVFPACGSRNSAIELTPKELSEFSFSKVWIDVCKDWE
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtctctaaaaagtgtgagaacccactttactcaatggaatcgagaaaatgatgtgacg
gagttcgaaacgtcgagtgcgacagttgaacaggcagctgagacaatcggcgtaagcctg
tctagaatcgccaagtccctgtccttcagaggggaaggagatcaggtgattctgattgtg
gcagccggcgatgccaagatcgacaacaaaaagtccaggcaaacatttggctttaaagca
agaatgctctctcctaatgaggtgctggagcagacaggccatgaaattggaggagtttgc
ccatttggattggctcatgatcctgaggtttatcttgatgtatcgctgaaacggtttcag
actgttttccccgcatgcggcagcagaaactccgctattgaattaacaccgaaagaatta
tccgaattttctttctcaaaagtgtggattgatgtttgtaaagactgggaataa

DBGET integrated database retrieval system