KEGG   Bacillus subtilis subsp. subtilis 168: BSU37490Help
Entry
BSU37490          CDS       T00010                                 

Gene name
speB
Definition
(RefSeq) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00330  Arginine and proline metabolism
bsu01100  Metabolic pathways
Module
bsu_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BSU37490 (speB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BSU37490 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 937205
NCBI-ProteinID: NP_391629
Pasteur: BG12461
BSORF: BG12461
UniProt: P70999
Position
complement(3847853..3848725)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIASRPEWEEADAILYGMPMDWTVSYRPGSRFGPSRIREVSIGLEEYSP
YLDRDLADLNFFDAGDIPLPFGNPQRSLDMIEEYVDSILEKGKFPMGMGGEHLVSWPVIK
AMYKKYPDLAIIHFDAHTDLRVDYEGEPLSHSTPIRKAAELIGPHNVYSFGIRSGMKEEF
EWAKENGMHISKFEVLEPLKEVLPKLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKE
LLASVHEIARSEVNVKGADLVEVAPVYDHSEQTANTASKIIREMLLGFVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagatttgatgaagcttattcaggaaaagtatttatcgcgagccgtcccgagtgggaa
gaggcggacgccattctttacggcatgccgatggactggacagtcagctatcgcccgggc
tcacgctttggtccaagcagaatccgtgaggtgtcaatcggccttgaggaatacagccca
tatttagaccgcgatctggctgacttgaacttctttgacgctggcgacattccgctgccg
ttcggaaatccgcagcgaagcctggatatgattgaagagtacgtggacagcattttagaa
aaagggaagttcccaatgggtatgggcggggagcacctcgtgtcatggcctgtcattaaa
gcgatgtacaagaaatacccagaccttgcgattatccattttgacgcacatacagatctt
cgtgttgattatgagggagaaccgctttctcactccacgccgatccgtaaggcggcagaa
ttgatcggaccgcacaatgtgtattcattcggaatccgttccggcatgaaagaagagttt
gaatgggcgaaggaaaacggcatgcacatctcaaaatttgaagtgcttgaaccgctgaaa
gaggtgcttccgaagctggcgggccgtccggtttatgtcacaattgacattgacgtatta
gaccctgcacacgcaccgggtacaggaacggttgacgccggcggcatcacgtctaaagaa
ctgcttgcatcggtccatgaaattgcgcgttcagaggtaaacgtaaagggcgctgattta
gtggaagtcgcgccggtatacgaccactcagagcaaacggcaaacacagccagcaaaatc
atccgtgaaatgctgcttgggtttgtgaaataa

DBGET integrated database retrieval system