KEGG   Bacillus subtilis subsp. subtilis 168: BSU37500
Entry
BSU37500          CDS       T00010                                 

Symbol
speE
Name
(RefSeq) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00330  Arginine and proline metabolism
bsu00480  Glutathione metabolism
bsu01100  Metabolic pathways
Module
bsu_M00034  Methionine salvage pathway
bsu_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU37500 (speE)
   00330 Arginine and proline metabolism
    BSU37500 (speE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSU37500 (speE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     BSU37500 (speE)
SSDB
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_12 NTP_transf_3
Other DBs
NCBI-GeneID: 937075
NCBI-ProteinID: NP_391630
Pasteur: BG12460
BSORF: BG12460
UniProt: P70998 A0A6M4JQC0
Structure
PDB: 
1IY9

Position
complement(3848786..3849616)
AA seq 276 aa
MSELWYTEKQTKNFGITMKVNKTLHTEQTEFQHLEMVETEEFGNMLFLDGMVMTSEKDEF
VYHEMVAHVPLFTHPNPEHVLVVGGGDGGVIREILKHPSVKKATLVDIDGKVIEYSKKFL
PSIAGKLDDPRVDVQVDDGFMHIAKSENQYDVIMVDSTEPVGPAVNLFTKGFYAGIAKAL
KEDGIFVAQTDNPWFTPELITNVQRDVKEIFPITKLYTANIPTYPSGLWTFTIGSKKYDP
LAVEDSRFFDIETKYYTKDIHKAAFVLPKFVSDLIK
NT seq 831 nt   +upstreamnt  +downstreamnt
ttgagcgaactttggtacacagagaagcagacgaaaaactttggcattacgatgaaggtt
aacaagacgttacatacagaacaaacggagtttcagcatttagaaatggtggaaacagaa
gagttcggcaacatgctttttttggacggcatggtgatgacatctgaaaaagacgaattc
gtttatcacgaaatggtggcgcatgtcccattattcacgcacccaaatccggagcacgtt
ctcgtagtcggcggcggtgacggcggcgttatcagagaaatcctgaagcacccaagcgtg
aaaaaagcgacacttgtagatattgacggcaaggttatcgaatactctaaaaagttcctt
ccttctatcgcaggcaaactggatgatccgcgcgttgacgtgcaggtagatgacggattt
atgcacattgcaaaatctgaaaatcaatatgacgtcatcatggtagattcgactgaacca
gtcggaccggctgtaaacctgtttacaaaaggattctacgcaggaatcgcaaaagcgctg
aaagaagacggtattttcgttgcgcagacggacaacccatggtttacaccggaattaatc
acaaatgtacagcgcgacgtgaaggaaatcttcccgattacgaagctgtatacggcgaac
attccgacatatccaagcggtttgtggacatttacaattggctcgaaaaaatatgatccg
cttgcagtggaagacagccgtttcttcgatattgagacgaaatattacacaaaagatatt
cataaagcggcgtttgttctgccgaaatttgtgagtgacctgattaaataa

DBGET integrated database retrieval system