KEGG   Bacillus subtilis subsp. subtilis 168: BSU37510
Entry
BSU37510          CDS       T00010                                 

Gene name
pbpG
Definition
(RefSeq) penicillin-binding protein 2D
  KO
K21464  penicillin-binding protein 2D [EC:2.4.1.129 3.4.16.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU37510 (pbpG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU37510 (pbpG)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU37510 (pbpG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BSU37510 (pbpG)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BSU37510 (pbpG)
Glycosyltransferases [BR:bsu01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   BSU37510 (pbpG)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BSU37510 (pbpG)
SSDB
Motif
Pfam: Transgly Transpeptidase
Other DBs
NCBI-GeneID: 937200
NCBI-ProteinID: NP_391631
Pasteur: BG12459
BSORF: BG12459
UniProt: P70997 A0A6M3ZLF9
Position
3849818..3851893
AA seq 691 aa
MDAMTNKRLRLTLKTVRAFIFLGAFAALAAAAVFMTVILIAKYQGAPSVQVPQSTILYAS
DGSKLGETNYGEKRYWVPLKDMNPTIVKATVAIEDQNFYDHHGFDYKRMAGAALADLKAF
AKVQGASTITQQYARNLYLEHDKTWKRKWNEAFYTIRLEQNYSKDEILEGYLNTIYYGHG
AYGIEAASRLYFGKHAKNLTDAEAALLAGIPKGPSGYSPYVNETKAKERQKTIVRMMEKQ
QMISQKKADELIKEPLSYQPLNKQVSKRKAPYFYDNAMRELEKKLGMTREQIETSGLNVY
TTVDKRMQRIAEETITETVNAGSDIQVGFSAIDPRTGNVLALVGGRDYQKSPFDRTTQAK
RQPASTIKPLLYYKAIQSGFTPVTLMKSEETEFQIDAKGETYSPSNYNGYYANKPITLLQ
ALALSDNIYAVKTHLFLGTNKLVKTAKEFGITAHLQALPSLALGTEPVRPIEMVNAYAML
ANGGKKIEPTFISRVTDAAGHVLYENPNQHKQVLDEKAAFVTASMMTGMFDIDLNGYTSV
TGRTIANRLTRTYAGKSGTTSADSWMIGFNPKLAAGVWTGYDKNSTIDSVEEKSYAKTIW
ADFMEDALKGEPETAFKPPKGVTGVYIDPETGYSSGPGCAAKHYTYFVKGTEPANVCYGA
EPAKQTKDRLPSKEKPASEKKWWDKWLGRHH
NT seq 2076 nt   +upstreamnt  +downstreamnt
gtggatgcaatgacaaataaacggctgagactgacgctgaaaaccgttcgcgcctttatc
tttttaggggcttttgcggccttggcggcagctgctgtgtttatgactgtcattttgata
gccaaataccagggcgctccctcggtgcaagtgccgcaatccacgattttgtacgcgagt
gacggctcaaagctcggggaaacgaactacggcgaaaagcgctattgggtccccttaaag
gacatgaatccgacgatcgtaaaagcgacagtggcgattgaagaccagaatttctacgat
catcacggctttgattataaacgcatggccggcgcggcgcttgctgacctgaaagcattt
gccaaggttcagggtgcaagcaccatcacccagcaatatgcgagaaacttataccttgaa
cacgacaaaacgtggaaacggaaatggaatgaggcgttctacacgatccgtctggaacaa
aactattctaaggacgagatattagaaggctatttaaatacgatttactacggccacggc
gcctacggcattgaagcagcttcccgcctgtatttcggcaagcatgccaaaaacctgacg
gatgcggaggcggcgcttttggcaggaatcccgaaaggcccttccggctattcaccgtat
gtcaatgagacgaaggccaaggaacgccagaaaacgattgtgcggatgatggaaaagcag
cagatgatcagccaaaagaaagcggatgaattgatcaaggaacctctttcctatcagcct
ttgaataaacaagtttccaagagaaaggctccttatttctacgacaatgcgatgagagag
ctggaaaaaaagctcggcatgacacgggagcaaattgaaacgagcgggttaaacgtctat
acaacggtagataaacggatgcagcgcatcgccgaggagaccattaccgaaacggttaac
gcgggctctgacattcaagtcgggttttcagccattgatccccgcaccggaaacgttctc
gcccttgtcggcggcagggattatcaaaaaagcccgtttgaccggacgacacaggcgaag
cgccagcctgcttcgacgatcaagccgttgctgtactataaagcgattcagagcggattt
acgccagtcactttgatgaaaagcgaagaaaccgagtttcaaattgatgcaaagggagaa
acctattctccaagcaactataacggatactatgccaacaagccgattacgcttctgcag
gcgctggcgctttccgacaatatttacgctgtgaaaacgcatctttttctcggcacgaac
aaacttgtaaagacggcaaaggaattcggcattaccgcccatcttcaagcactgccgtcc
ctggcactcggcaccgaacccgtacgtccgattgagatggtcaacgcctatgccatgctc
gcaaatggcggaaagaaaatcgaaccgacttttatttcaagagtaacggacgcagccggc
cacgtgctgtacgaaaacccgaatcagcataaacaggtgcttgatgaaaaagccgctttt
gtcacagcgagtatgatgacaggcatgtttgatatcgatttaaatggatatacgtcggtt
acggggcgaacgatagccaaccgcctgacaagaacgtatgccggaaaatcaggaaccacc
agcgcagacagctggatgatcggcttcaatccgaagctggccgccggtgtttggaccggc
tatgacaaaaacagcaccatcgactcggtcgaagaaaaaagctatgctaaaaccatttgg
gcggacttcatggaggacgcgctcaaaggcgaaccggaaaccgcgttcaagccgccaaaa
ggcgtaaccggtgtgtacattgatccggaaacaggctactcatcaggtcccggctgcgcc
gctaagcattacacatattttgtgaaagggacagaacccgcaaacgtgtgctacggggca
gaacccgcaaaacaaacaaaagaccggcttccatccaaagaaaagcccgcttccgagaaa
aagtggtgggacaaatggctggggcgacatcattga

DBGET integrated database retrieval system