KEGG   Bacillus subtilis subsp. subtilis 168: BSU37520
Entry
BSU37520          CDS       T00010                                 

Gene name
ywhD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YwhD
Other DBs
NCBI-GeneID: 937100
NCBI-ProteinID: NP_391632
Pasteur: BG12458
BSORF: BG12458
UniProt: P70996 A0A6M3ZI73
Position
complement(3852186..3852704)
AA seq 172 aa
MEEKKKKSIGFNIIKSDPTDGHGGFGVGALSLDNISPVFVDVEEKEAFVDIGAMHARSTV
EKGIKFLPNKEEVPNGKPYWLVWVTIDRKEEGPYYAGVTACEMTVDRSIRRGYKSLPEHV
NLMDKSMKRKIIVDKMDDSSKRVLGEFLKKHDQGLWDRSSDELKTSLLPENN
NT seq 519 nt   +upstreamnt  +downstreamnt
atggaagaaaaaaagaaaaaatcaatcgggtttaatattatcaaaagtgatccgacagac
ggacacggcggttttggcgtaggggcactcagccttgataacatttctcccgtattcgtt
gatgtagaggaaaaagaagcgttcgtagacatcggcgctatgcatgcccgcagcaccgtt
gaaaaaggaattaaatttctcccgaataaagaagaagtgccgaacggaaaaccatactgg
cttgtgtgggtaacgattgacagaaaagaagaggggccttattacgctggtgtgacagcc
tgtgaaatgacggtcgacagaagcatcagaagaggctacaagtcactgcctgagcatgtg
aatctgatggataaatccatgaaacggaaaatcatcgttgataaaatggacgacagctcg
aagcgtgtactaggcgaatttctgaaaaagcatgatcagggcctatgggaccgttcctca
gatgagttaaaaacgagcctgcttccagaaaacaattaa

DBGET integrated database retrieval system