KEGG   Bacillus subtilis subsp. subtilis 168: BSU37530
Entry
BSU37530          CDS       T00010                                 

Gene name
ywhC
Definition
(RefSeq) zinc metalloprotease YwhC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_M50
Other DBs
NCBI-GeneID: 937099
NCBI-ProteinID: NP_391633
Pasteur: BG12457
BSORF: BG12457
UniProt: P70995 A0A6M4JQC8
Position
complement(3852718..3853377)
AA seq 219 aa
MDRFLYYPLSLMPYLVITLIVSFTMHELAHAYVAYKFGDDTAKKQGRLTLNPIKHLDPFG
TILILVAGFGWARPIPVNRRFFKKPRLAGVLVSIAGPVSNLILAFIGFFLLVLMHAYGME
MLAAFSTGLDQFFSIWIQLNLVLFLFNLLPLPPLDGYRIIEDLVPPGVRAKMTQAESYGF
IVFLVLFVTPLGSYVLWPMLNAGRDSILKLFSAIFQPLL
NT seq 660 nt   +upstreamnt  +downstreamnt
ttggaccgttttttatattatccgttatctttaatgccatacctcgtcatcacgctaatt
gtgtcgtttacgatgcacgagcttgcccacgcttatgtcgcatacaaattcggtgacgat
acggcgaaaaaacaaggaagactgacgctgaatcccattaaacaccttgatccgttcgga
accattttgattctggtggccggattcgggtgggcgcgccccattcccgtgaatcgccgt
ttctttaagaaaccccggcttgctggtgtgctcgtatctatagccgggcccgtcagtaac
ctgattcttgcgtttattggtttctttttgttagtgttgatgcatgcgtacggaatggaa
atgcttgcggcgttcagcacggggctggatcagtttttttctatttggatacagctgaat
cttgtcttgtttttatttaatctgctgccgcttcctccgctcgatggctatcgaattata
gaagatctcgttccgccgggcgtgcgtgccaaaatgacgcaggcggagagctacggcttt
atcgtatttttggtgctgtttgtgacaccgctaggatcttacgtgctgtggccgatgctc
aatgcaggaagagattcgattttaaagctgttttcagcgatatttcaaccgcttttgtag

DBGET integrated database retrieval system