KEGG   Bacillus subtilis subsp. subtilis 168: BSU37540
Entry
BSU37540          CDS       T00010                                 

Symbol
ywhB
Name
(RefSeq) 2-hydroxymuconate tautomerase
  KO
K01821  4-oxalocrotonate tautomerase [EC:5.3.2.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00362  Benzoate degradation
bsu00622  Xylene degradation
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSU37540 (ywhB)
   00622 Xylene degradation
    BSU37540 (ywhB)
   00621 Dioxin degradation
    BSU37540 (ywhB)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.6  2-hydroxymuconate tautomerase
     BSU37540 (ywhB)
SSDB
Motif
Pfam: Tautomerase Tautomerase_2 CHMI TBC1D23_C
Other DBs
NCBI-GeneID: 937098
NCBI-ProteinID: NP_391634
Pasteur: BG12456
BSORF: BG12456
UniProt: P70994 A0A6M3ZHJ8
Structure
PDB: 
2OPA 2OP8

Position
3853486..3853674
AA seq 62 aa
MPYVTVKMLEGRTDEQKRNLVEKVTEAVKETTGASEEKIVVFIEEMRKDHYAVAGKRLSD
ME
NT seq 189 nt   +upstreamnt  +downstreamnt
atgccatacgtaactgtcaaaatgctcgaaggccgtacagacgagcaaaaacgcaatctt
gtcgagaaagtaacagaagccgtaaaggaaacaaccggtgcttctgaagaaaaaattgtt
gtctttatagaagaaatgagaaaagaccattatgccgtcgcaggcaaacgcctgagcgat
atggaataa

DBGET integrated database retrieval system