KEGG   Bacillus subtilis subsp. subtilis 168: BSU37550
Entry
BSU37550          CDS       T00010                                 

Gene name
ywhA
Definition
(RefSeq) HTH-type transcriptional regulator YwhA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: MarR MarR_2 HTH_24 Penicillinase_R HTH_27 HTH_34 HTH_5 DUF6429 HTH_IclR TrmB FaeA LexA_DNA_bind TFIIE_alpha BLUF HxlR DUF5830 PadR HTH_45
Other DBs
NCBI-GeneID: 937081
NCBI-ProteinID: NP_391635
Pasteur: BG12455
BSORF: BG12455
UniProt: P70993 A0A6M4JQA8
Position
complement(3853717..3854136)
AA seq 139 aa
MDHDKLEANLLDHALTKYLKSTKQLDEATVPKHVNNVRGFILRIIYRHGSCTIKDILKEV
TLSPSATTTALNHLEQEGFIERSRNNNDRRTVWITLSESGRGAAEQMIENRQQLIDGMFE
RLTAEEKKTFLAIIAKLAQ
NT seq 420 nt   +upstreamnt  +downstreamnt
atggaccatgacaaactggaagcaaatttgctggatcacgcacttacaaagtatttgaaa
agcacgaagcaattagatgaagccaccgttccgaaacacgtgaataatgtaagagggttt
attctgcggatcatatacagacatgggagctgcaccataaaggatattttgaaggaggtc
acactgtctccctctgccacgaccacagctctgaatcatttagagcaggaagggtttatt
gagagatccagaaataacaatgaccgccgcactgtatggattactctttctgaatcgggc
cggggagcggctgaacaaatgatcgaaaaccgccagcagctgattgatggcatgtttgaa
cgtttaacagccgaagagaaaaagacgttcttggcgattattgcgaagctggctcaatag

DBGET integrated database retrieval system