KEGG   Bacillus subtilis subsp. subtilis 168: BSU37580
Entry
BSU37580          CDS       T00010                                 

Symbol
ywgB
Name
(RefSeq) HTH-type transcriptional regulator YwgB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Rrf2 HrcA_DNA-bdg MarR_2 HTH_20 HTH_24 TFIIE_alpha MarR Dynactin GntR TrmB HTH_Crp_2 HTH_IclR
Other DBs
NCBI-GeneID: 937074
NCBI-ProteinID: NP_391638
Pasteur: BG12454
BSORF: BG12454
UniProt: P71047 A0A6M4JQ91
Position
complement(3858417..3858887)
AA seq 156 aa
MKMKSGMEQAVSVLLLLSRLPVQASLTSEAISQRLRVSPSYLKKLMRTLVQAGLAESLPG
TKGGFTLTKPLADITLYDVYQAVEGRGSMYQGKGLLQSVFEGESHCVLETVMAEIEDKWS
NLMREESLQHVMDRVGELYDLEKIDDWVIKQVKGQL
NT seq 471 nt   +upstreamnt  +downstreamnt
atgaaaatgaaatcaggaatggagcaggcggtttctgtgctgctgttactgtcacggctg
ccggtacaggcttctttgacgtcagaggctataagccagcgattgcgcgtgtctccgtct
tacttgaagaagctgatgagaacattggttcaagccggtttggcagaatccttaccaggg
acgaagggcggttttaccctgacgaagcctttggctgacattacgctttatgatgtttat
caagcggtcgaaggcagaggttcgatgtatcaggggaaaggcttgctgcaatctgtattt
gagggtgaaagtcactgtgtgctggagacagtcatggcggaaatcgaggataaatggtcc
aatcttatgagagaagaatccttgcagcatgttatggacagagtcggggaattgtatgat
cttgaaaaaatagatgattgggtaatcaagcaagtgaaagggcaattgtaa

DBGET integrated database retrieval system