KEGG   Bacillus subtilis subsp. subtilis 168: BSU37590Help
Entry
BSU37590          CDS       T00010                                 

Gene name
ywgA
Definition
(RefSeq) hypothetical protein
  KO
K09388  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU37590 (ywgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Replic_Relax
Motif
Other DBs
NCBI-GeneID: 937077
NCBI-ProteinID: NP_391639
Pasteur: BG12453
BSORF: BG12453
UniProt: P71046
Position
complement(3858999..3859499)
Genome map
AA seq 166 aa AA seqDB search
MLKEHAKLMKVFSDSGEIIGRKKLQKMIYIAKKMQFPFYEKYDFHFYGPYSEELTLQIEE
LCNLGFLHEVKEKKGGYFQYRYSLTETGSAFLDHADLDMPDMKGYIDSVNSRSSRFLELV
STILYFDGLEDEEKKEKVFTIKSKQKYTNEEYDEALQYIEELKQIC
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaaagaacatgcaaaactgatgaaggtgttctcggattctggagaaatcatcggg
cgaaagaagctgcagaaaatgatttatatcgccaagaaaatgcagtttcctttctatgag
aaatatgattttcacttttacggaccatattcagaggaactgacgctccagattgaagag
ctgtgcaaccttggatttctgcatgaggtgaaggaaaaaaagggcggctactttcaatac
cggtattcgctgactgagacaggctccgcatttttagaccatgctgatctggacatgccg
gatatgaaaggctatatcgacagtgtaaacagccgttcatcacggtttttagagctggtt
tccacgatcctttactttgacgggcttgaggatgaggaaaagaaagaaaaagtctttacc
atcaaaagcaagcaaaaatatacaaatgaagaatatgacgaagcgcttcaatacatagag
gaactgaagcagatttgttaa

DBGET integrated database retrieval system