KEGG   Bacillus subtilis subsp. subtilis 168: BSU37600
Entry
BSU37600          CDS       T00010                                 

Gene name
ywfO
Definition
(RefSeq) hypothetical protein
  KO
K06885  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU37600 (ywfO)
SSDB
Motif
Pfam: HD HD_assoc_2 DUF977
Other DBs
NCBI-GeneID: 937082
NCBI-ProteinID: NP_391640
Pasteur: BG10639
BSORF: BG10639
UniProt: P39651 A0A6M3ZHR8
Position
complement(3859535..3860836)
AA seq 433 aa
MAYPNGKLSEEKVFKDPVHRYVHVRDKLIWDLIGTREFQRLRRIKQLGTTYLTFHGAEHS
RFNHSLGVYEIVRRMVDDVFKGRPEWDDSERELCLAAALLHDLGHGPFSHSFEKVFHLDH
EDFTRGIILGDTEVNQVLRKVSPGFPQDVAEVIAKTYKNKQVVSLISSQIDADRMDYLQR
DAYYTGVSYGHFDMERILRVMRPREDQIVIKESGMHAVEDYIMSRYQMYWQVYFHPVTRS
AEVILTKILHRAKQLHDEGYVFTHAPVHFYSIFEGKLTLEDYVKLDESIILYYFQAWEDE
EDAILSDLCRRFINRQLFQYVEFNPNEEMSAYFELTSLFKEAGIDPSYYLVVDSSSDLPY
DFYRPGEEEERLPIHLLTQNGQIKELSRQSAIVESISGKRRTDHKLYYPKDLICDGTKHP
EAKMKIRQLLGLT
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcgtatccaaatggaaaattatcagaagaaaaagtgtttaaagatccggtgcaccgc
tatgttcatgttcgggacaagctgatatgggatttgatcggaacccgtgaatttcagcgt
ctccgcagaattaagcagctcggaacgacctatttgacgttccatggggctgagcacagc
cggttcaaccattctctcggtgtctatgaaattgtcagaagaatggttgatgacgtcttt
aaaggccgccctgaatgggatgacagtgagcgcgaactctgtttggccgcggcgctgctt
catgacctcgggcacgggccgttctcgcattcatttgaaaaggtctttcaccttgaccac
gaggattttacaagaggtatcattttgggagacacggaggttaatcaggtgctcagaaag
gtgagcccgggtttccctcaggatgttgctgaagtcattgccaaaacatataaaaacaag
caagtggtcagcctgatttcgagtcagattgacgcagaccgcatggattacctccagcgc
gacgcatattatacgggcgtcagctacggccattttgatatggagcggattcttcgggtg
atgcggccgcgcgaggatcagatcgtcattaaagaaagcggaatgcacgctgtcgaagac
tatatcatgagccgttaccaaatgtactggcaggtctacttccatcctgtgactagaagt
gcagaggtcattttaacgaagattcttcacagggcgaagcagctgcacgatgaaggctat
gtcttcactcacgctccggttcatttctattctatttttgaaggaaaattgacactggag
gattatgtaaagctggatgaatctattattttgtattacttccaggcctgggaggatgaa
gaagacgcgattttatccgacttgtgccgcagattcattaaccgccagcttttccaatac
gttgaattcaatccgaatgaagaaatgtcggcttattttgagctgacttcattgttcaaa
gaggcggggatcgatccgagctattatttggtcgttgattcttcatcagatctgccatac
gatttttaccgaccaggagaggaagaggagcgtctgccgatccatctcttgacgcaaaac
ggccaaattaaagagctgtccagacagtcggctattgtggaatccatctcaggtaaacgg
cggacggaccacaagctgtactatccaaaggacttgatttgtgacggcactaaacatccg
gaagcgaaaatgaaaatccggcagctgctgggactgacatag

DBGET integrated database retrieval system