KEGG   Bacillus subtilis subsp. subtilis 168: BSU37610
Entry
BSU37610          CDS       T00010                                 

Gene name
ywzC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1450
Other DBs
NCBI-GeneID: 937093
NCBI-ProteinID: NP_391641
Pasteur: BG14164
BSORF: BG14164
UniProt: O32280 A0A6M4JQ90
Position
complement(3860998..3861222)
AA seq 74 aa
MANEFRVCDDCQATNIKTLLPRLKEVDPDAKVEVGCQSYCGPGRKKSFAFVNNRPLSAPT
EDELIDKVKKKIKK
NT seq 225 nt   +upstreamnt  +downstreamnt
atggctaatgaatttcgagtgtgtgatgattgccaagccactaatatcaaaacattgctg
ccgcgtttgaaagaagtggacccggacgcaaaggttgaggtaggatgccaatcttattgc
gggcccggacggaaaaaatcatttgcttttgtgaacaatcgcccgctgtcagctccgaca
gaggatgagctgattgacaaagtaaaaaagaaaataaaaaagtaa

DBGET integrated database retrieval system