KEGG   Bacillus subtilis subsp. subtilis 168: BSU37620
Entry
BSU37620          CDS       T00010                                 

Gene name
rsfA
Definition
(RefSeq) prespore-specific transcriptional regulator RsfA
  KO
K06314  prespore-specific regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU37620 (rsfA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU37620 (rsfA)
Motif
Pfam: ZapB KASH_CCD DivIC Myb_DNA-bind_6 XRCC4 UPF0449 Leu_zip Seadorna_VP6 ADIP TolA_bind_tri Myb_DNA-binding ACP_PD dsRBD2 YqhG PilJ Lectin_N DUF4337 Methyltransf_14 Spc24 Rota_NSP3 Exonuc_VII_L V_ATPase_I OmpH DUF1664
Other DBs
NCBI-GeneID: 937126
NCBI-ProteinID: NP_391642
Pasteur: BG10638
BSORF: BG10638
UniProt: P39650 A0A6M3ZI82
Position
3861437..3862213
AA seq 258 aa
MTKQRQDAWSEENDLLLAETVLRHVREGSTQLNAFEEVGDKLNRTSAACGFRWNAVVRHQ
YEKALQLAKKQRKQRMRALGNGQPAKKRLLYQPPAVDPEIIQETAAEEPVKTETPSVENE
QPLMSGEHMPFVDESFKEELASLSHLLSPQTPAAAPEMTMNDVIRFLQNYEGNHEQSSAL
KMENERLKKENQELQNKTEQLEAEVQKLEKDQKTIQEDYETLVKIMNRARKLVLFEEDEH
ASPSFKMDRNGNLEKLAE
NT seq 777 nt   +upstreamnt  +downstreamnt
atgacaaaacagcgacaagacgcttggtcagaggaaaacgatctgcttttagccgaaaca
gtgcttcggcatgtgagggagggcagcactcagctgaacgcctttgaagaagtcggcgat
aaattaaaccggacatccgcagcctgcggattcagatggaacgcagtggtccgccatcaa
tatgaaaaagcgcttcagcttgcgaagaaacaacgaaaacagcggatgagagcgctcgga
aacgggcagcccgcgaaaaaaagattattatatcagcctcctgccgttgatcctgaaatc
attcaagaaaccgctgcagaagagccggttaaaacggaaacaccatctgtcgaaaatgag
caacctttaatgtctggcgaacacatgccttttgttgatgaaagctttaaggaagagtta
gctagtctatcacacttattgtctcctcaaacgcctgcagctgcgcctgagatgacgatg
aatgatgtgatccgcttcctgcagaattacgaaggcaatcacgagcaatcatcagcatta
aaaatggaaaacgagcgtttaaagaaagaaaatcaggaattgcaaaacaaaacagagcag
ctagaggcagaagttcaaaagcttgaaaaagaccaaaaaacgatccaagaagattatgaa
accttggtgaaaattatgaacagagccagaaagctagttttatttgaagaagatgaacat
gcctctccgtccttcaaaatggaccggaacggcaatttagaaaaattagcggaatga

DBGET integrated database retrieval system