KEGG   Bacillus subtilis subsp. subtilis 168: BSU37630Help
Entry
BSU37630          CDS       T00010                                 

Gene name
ywfM
Definition
(RefSeq) transporter
  KO
K03298  drug/metabolite transporter, DME family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU37630 (ywfM)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU37630 (ywfM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA TPT TMEM234 YtpI Nuc_sug_transp
Motif
Other DBs
NCBI-GeneID: 937972
NCBI-ProteinID: NP_391643
Pasteur: BG10637
BSORF: BG10637
UniProt: P39649
Position
complement(3862357..3863247)
Genome map
AA seq 296 aa AA seqDB search
MKGNIYSLFVLIAAFFWGTTGTVQALAPESATPLAFGAFRLLIGGSAMLLAVWISRELHV
KNWAWPLVFLAAVCMACYQPLFFTAVKETGIAVGTVIAIGSAPIIAGTLEWAVLKKRPRN
SWWIATVLALAGCWLLFSDSSNVRIDVAGVLMALGAGASFAGYTLISKAMMKTQPPRATS
AVVFMISAILLTPLLWQLDISWILTPRGLGTSLYIGLIATCAAYFLFAKGLTGVPASAAV
TLSLAEPLTASLLGVFFIGEMLSPSSWLGIALMMLGLLVISAAPRKQKTAEAAHMS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggaatatttacagcctttttgtattgattgcggcttttttctgggggaccacg
ggaaccgttcaggcattggctccagaaagcgccacaccgctggcatttggagcgttcagg
ttattaataggaggaagcgccatgctgcttgcggtttggatcagccgggagcttcacgtg
aaaaattgggcatggccgctcgtatttttagccgctgtttgtatggcgtgttaccagccg
ctgtttttcacagcggttaaagaaacgggaattgcagtgggaactgtgattgccatcggc
agtgcgcctatcattgccgggaccctcgaatgggctgtattgaagaaacgcccgcgaaac
tcctggtggattgcgactgtgctggctttagcgggttgctggcttctgttttccgacagt
tccaatgttcggattgatgtggctggtgttcttatggcgcttggagcgggtgcttctttt
gcaggctatacgctcatcagtaaagcgatgatgaaaacccagcctccgcgagcgacctcc
gccgttgtattcatgatcagcgccatcttgctgacgccgctattatggcagttagatatc
tcgtggatattgacccctagaggactgggaacaagcctttacatcgggttaattgcaaca
tgtgccgcatactttttgtttgcgaaagggcttaccggggttccggcctcggcggcggtc
acgctgtctttagctgaaccgctgacggcttcattgcttggcgtgtttttcataggggaa
atgctttcgccttcctcgtggctgggcattgcgcttatgatgctggggcttttggtcatt
tctgctgcgcctcggaaacaaaaaacggccgaggcagctcacatgtcttaa

DBGET integrated database retrieval system