KEGG   Bacillus subtilis subsp. subtilis 168: BSU37640
Entry
BSU37640          CDS       T00010                                 

Gene name
ywfL
Definition
(RefSeq) octanoyl-[GcvH]:protein N-octanoyltransferase
  KO
K16869  octanoyl-[GcvH]:protein N-octanoyltransferase [EC:2.3.1.204]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00785  Lipoic acid metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00883  Lipoic acid biosynthesis, animals and bacteria, octanoyl-ACP => dihydrolipoyl-H => dihydrolipoyl-E2
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    BSU37640 (ywfL)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.204  octanoyl-[GcvH]:protein N-octanoyltransferase
     BSU37640 (ywfL)
Motif
Pfam: BPL_LplA_LipB
Other DBs
NCBI-GeneID: 937083
NCBI-ProteinID: NP_391644
Pasteur: BG10636
BSORF: BG10636
UniProt: P39648 A0A6M3ZHK8
Position
complement(3863415..3864260)
AA seq 281 aa
MANQPIDLLMQPKWRVIDQSSLGPLFDAKQSFAMDDTLCMSVGKGVSPATARSWVHHDTI
VLGIQDTRLPFLQDGISLLESEGYRVIVRNSGGLAVVLDDGVLNISLIFEDEKKGIDIDK
GYEAMVELMRRMLRPYNAKIEAYEIEGSYCPGSYDLSINGKKFAGISQRRVRGGVAVQIY
LCADKSGSERADLIRRFYQAALKDKQNDKKGVYPEIRPETMASLSELLQKDISVQDLMFA
LLTELKALSTHLYSAGLSIDEEMEFEKNLVRMAERNAKVFG
NT seq 846 nt   +upstreamnt  +downstreamnt
atggcaaaccaaccgattgatttactgatgcagccgaaatggagagtcattgaccaatcc
agtctcggccctttatttgatgcgaagcaatccttcgcaatggatgatacgctatgcatg
tccgtcggaaaaggcgtgtcgccggcgacagcgcgctcatgggtgcaccacgatacaatt
gtccttggaatacaggatacacgcctcccgtttttgcaggatggtatctccttgctggag
agcgaaggataccgtgtgatcgtacgcaattccggcggtcttgccgtcgtattggatgac
ggtgttttaaatatctctctcatattcgaggacgaaaagaaaggcatcgatatagacaaa
ggatatgaagcgatggtcgagctgatgagacgaatgctgagaccgtacaacgcaaagatc
gaagcctatgaaattgaagggtcttattgtcccggcagctatgacctcagtataaatggc
aaaaagttcgccggcatctctcagagacgcgttcgcggcggagtcgctgttcaaatttat
ctctgtgcagataaaagcggcagtgaaagggccgacttgatcagacgattctatcaagcg
gcgctgaaagacaaacaaaacgataaaaaaggcgtctatccggaaatacgtccggaaacg
atggcgtccttaagtgagcttcttcaaaaagacatctccgtacaagacttaatgttcgct
ttattgacggaattaaaagcgttaagcacccatctttattcagctggactgtccattgat
gaggaaatggaatttgagaaaaacctcgtccggatggctgagcggaatgcaaaggtattt
gggtga

DBGET integrated database retrieval system