KEGG   Bacillus subtilis subsp. subtilis 168: BSU37650
Entry
BSU37650          CDS       T00010                                 

Gene name
cysL
Definition
(RefSeq) HTH-type transcriptional regulator CysL
  KO
K21900  LysR family transcriptional regulator, transcriptional activator of the cysJI operon
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU37650 (cysL)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    BSU37650 (cysL)
SSDB
Motif
Pfam: LysR_substrate HTH_1 PBP_like HTH_5 MarR
Other DBs
NCBI-GeneID: 936502
NCBI-ProteinID: NP_391645
Pasteur: BG10635
BSORF: BG10635
UniProt: P39647 A0A6M3ZHM0
Position
complement(3864309..3865208)
AA seq 299 aa
MYYDVLKTFIAVVEEKNFTKAAEKLMISQPSVSLHIKNLEKEFQTALLNRSPKHFTTTPT
GDILYQRAKQMVFLYEQAKAEIYAHHHYVKGELKIAASFTIGEYILPPLLAQLQKLYPEL
NLDVMIGNTEEVSERVRMLQADIGLIEGHTNENELEIEPFMEDEMCIAAPNQHPLAGRKE
ISISDLQNEAWVTREKGSGTREYLDHVLSSNGLRPKSMFTISSNQGVKEAVINGMGLSVL
SRSVLRKDLIHREISILHINNFSLKRKLSYIHSPLMENTKNKEIFITMLKSNYQSQLLK
NT seq 900 nt   +upstreamnt  +downstreamnt
ttgtattacgacgtgctgaaaacgtttatagcggtggtagaagaaaaaaacttcacaaaa
gcggcggaaaagctgatgatctcccagcccagcgtcagtctgcatatcaaaaatcttgag
aaagaatttcaaacggctcttctgaacaggtcgccaaaacactttacgacaacgccgaca
ggagacattttatatcaaagagcaaagcaaatggtgtttctctacgaacaagccaaggct
gaaatctatgcgcatcatcactatgtgaagggtgaattgaaaatagctgcaagctttaca
atcggtgagtatattcttccgccgctattggcccagctgcaaaagctgtatccagagctg
aatctagatgtcatgattggcaatacagaggaggtcagcgagcgtgtgcggatgcttcag
gctgatatcgggctgattgaaggacatacaaacgagaatgagctggaaattgaaccgttc
atggaggatgaaatgtgcattgccgctccaaatcagcatccgctcgccgggcggaaagag
atttcgatcagcgatttgcagaacgaagcgtgggtgacaagagagaaaggctccgggacg
agagaatatctcgatcatgtactcagttcaaatggacttcggccgaaatcaatgtttacc
atcagcagcaatcaaggtgtaaaggaagcggtgattaacggcatgggactttcggttcta
tccagaagcgtgctgcgtaaggatttgatccaccgcgaaatttcaattctgcatattaat
aatttctcgttaaagcgcaagctgtcttacattcattctcctctcatggagaatacaaaa
aataaagaaatttttattacgatgctgaaaagcaattatcaatcacagctgctgaaatga

DBGET integrated database retrieval system