KEGG   Bacillus subtilis subsp. subtilis 168: BSU37660Help
Entry
BSU37660          CDS       T00010                                 

Gene name
eutD
Definition
(RefSeq) phosphate acetyltransferase
  KO
K00625  phosphate acetyltransferase [EC:2.3.1.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00430  Taurine and hypotaurine metabolism
bsu00620  Pyruvate metabolism
bsu00640  Propanoate metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Module
bsu_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU37660 (eutD)
   00640 Propanoate metabolism
    BSU37660 (eutD)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU37660 (eutD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BSU37660 (eutD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     BSU37660 (eutD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB LPD7 FrhB_FdhB_N
Motif
Other DBs
NCBI-GeneID: 936581
NCBI-ProteinID: NP_391646
Pasteur: BG10634
BSORF: BG10634
UniProt: P39646
Structure
PDB: 

Position
complement(3865355..3866326)
Genome map
AA seq 323 aa AA seqDB search
MADLFSTVQEKVAGKDVKIVFPEGLDERILEAVSKLAGNKVLNPIVIGNENEIQAKAKEL
NLTLGGVKIYDPHTYEGMEDLVQAFVERRKGKATEEQARKALLDENYFGTMLVYKGLADG
LVSGAAHSTADTVRPALQIIKTKEGVKKTSGVFIMARGEEQYVFADCAINIAPDSQDLAE
IAIESANTAKMFDIEPRVAMLSFSTKGSAKSDETEKVADAVKIAKEKAPELTLDGEFQFD
AAFVPSVAEKKAPDSEIKGDANVFVFPSLEAGNIGYKIAQRLGNFEAVGPILQGLNMPVN
DLSRGCNAEDVYNLALITAAQAL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatttattttcaacagtgcaagaaaaagtagctggaaaagacgttaaaattgta
tttcctgaaggcttagacgagcgtattttagaagcggtcagcaagcttgcaggaaacaaa
gtgctgaatccgattgtgatcggcaatgaaaatgagatccaagcaaaagcaaaagaattg
aaccttacgctgggcggcgttaagatttatgatcctcatacatatgaaggcatggaagac
cttgtacaagcattcgtagaacgccgcaaaggcaaagcgactgaagaacaggctcgtaaa
gcattattagacgagaactacttcggtacaatgctggtgtataaaggacttgcagacgga
cttgtaagcggagctgctcactcaactgctgacactgtccgcccggctcttcaaatcatc
aaaacaaaagaaggcgtgaaaaagacttcaggcgtgttcatcatggctcgcggagaagag
caatacgtattcgcagattgcgcgatcaacattgcacctgacagccaagatcttgccgag
attgcgatcgaaagtgccaatacggcaaaaatgttcgacattgagcctcgcgtggcaatg
ctcagcttctctacaaaaggctcagcaaaatctgatgaaacagaaaaagtagcggatgca
gtgaaaatcgcgaaagaaaaagcgcctgaactgacacttgacggcgaattccaatttgat
gctgcatttgttccatctgtagctgagaaaaaagcgccggattccgagatcaaaggggac
gctaacgtattcgtattcccaagtcttgaagcaggaaacatcggctataaaatcgctcag
cgtttgggcaactttgaagcggtaggaccaatcctgcaaggtttaaatatgcctgtaaac
gacctttcaagaggatgtaacgctgaagatgtttacaatctcgcattaattacagcggcg
caagcactgtaa

DBGET integrated database retrieval system