KEGG   Bacillus subtilis subsp. subtilis 168: BSU37680
Entry
BSU37680          CDS       T00010                                 

Symbol
ywfH
Name
(RefSeq) bacilysin biosynthesis oxidoreductase YwfH
  KO
K19550  bacilysin biosynthesis oxidoreductase BacG [EC:1.3.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00998  Biosynthesis of various secondary metabolites - part 2
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSU37680 (ywfH)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     BSU37680 (ywfH)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-GeneID: 937215
NCBI-ProteinID: NP_391648
Pasteur: BG10632
BSORF: BG10632
UniProt: P39644 A0A6M4JQA1
Structure
PDB: 
3U49 3U4C 3U4D

Position
3867493..3868272
AA seq 259 aa
MSKRTAFVMGASQGIGKAIALKLADQHFSLVINSRNLDNIESVKEDILAKHPEASVIVLA
GDMSDQHTRAGIFQKIESQCGRLDVLINNIPGGAPDTFDNCNIEDMTATFTQKTVAYIDA
IKRASSLMKQNEFGRIINIVGNLWKEPGANMFTNSMMNAALINASKNISIQLAPHNITVN
CLNPGFIATDRYHQFVENVMKKNSISKQKAEEQIASGIPMKRVGSAEETAALAAFLASEE
ASYITGQQISADGGSMKSI
NT seq 780 nt   +upstreamnt  +downstreamnt
ttgtcaaaacgaaccgcatttgttatgggagccagtcaagggatcgggaaagcaatcgct
ctgaaattagcagaccagcacttttccctcgtcattaattcgcgaaatttggataatatt
gaatctgtcaaagaagacattttggccaagcatcctgaggcgagcgtcattgtccttgcg
ggcgatatgtctgaccagcatacgagagcgggcatttttcagaaaatcgaatctcaatgc
ggacggcttgatgttctgattaataatatcccgggcggcgcgcctgacacatttgataac
tgcaatatagaggatatgacggccacgttcactcaaaagaccgttgcctatattgacgca
atcaagcgtgcttcctcactgatgaaacaaaacgagtttggcagaatcatcaacattgtc
ggaaatctgtggaaagaacccggcgccaacatgttcacaaacagtatgatgaatgccgct
ttaattaacgccagtaaaaatatttccatccagcttgctcctcacaacattactgtcaac
tgtctgaatcctggttttatcgctacagaccgttatcatcaatttgtggaaaatgtgatg
aaaaagaacagcatatccaaacagaaagcagaagaacagattgcttccgggattccgatg
aaacgggtcggatcagccgaagaaaccgcagcgctcgccgcatttcttgcctctgaggaa
gcctcctacatcacgggacagcaaatttccgctgacggcggcagcatgaaaagcatataa

DBGET integrated database retrieval system