KEGG   Bacillus subtilis subsp. subtilis 168: BSU37700
Entry
BSU37700          CDS       T00010                                 

Symbol
bacE
Name
(RefSeq) bacilysin exporter BacE
  KO
K19552  MFS transporter, DHA3 family, bacilysin exporter BacE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU37700 (bacE)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-3 (12 spanner) (DHA3) [TC:2.A.1.21]
    BSU37700 (bacE)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 937161
NCBI-ProteinID: NP_391650
Pasteur: BG10630
BSORF: BG10630
UniProt: P39642 A0A6M3ZHT1
Position
complement(3869487..3870671)
AA seq 394 aa
MKQLKPNSKYLLYGQALSFMGDYCVLPALLILSTYYHDYWVTSGVIVVRSIPMVFQPFLG
VLVDRLDRIKIMLWTDIIRGIIFLGLTFLPKGEYPLIFLALLFITYGSGVFFNPARLAVM
SSLESDIKSINTLFAKATTISIIVGAAAGGLFLLGGSVELAVAFNGVTYLVSAFFISRIK
LQFVPIQSENIKEAFQSFKEGLKEIKTNSFVLNAMFTMITMALLWGVVYSYFPIVSRFLG
DGEIGNFILTFCIGFGGFIGAALVSKWGFNNNRGLTYFTVLSIVSLALFLFTPIFAVSVI
AAILFFIAMEYGEVLAKVKVQENAANQIQGRIFSVAEASIGLCISIGSMFINILSAPVIM
GLIVVIVCGLFLHTKLVNKSFLERDNKTEQKGVF
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaaacagctgaaacccaactctaaatacttgctttacgggcaggcgctatcgttcatg
ggagactattgtgttctccctgccctgctcattttgtctacatattatcacgattattgg
gtgacgtccggggtcatcgtggtcagaagcattccgatggtgtttcagccgtttttgggt
gttctggtcgaccggttagacagaattaagatcatgctgtggacggatatcatcagaggc
atcatctttttggggctcacatttcttccaaaaggcgagtatccgctgatttttctggcc
ctgctgtttattacttatggaagcggcgtgttttttaatcccgcccgtctcgctgtcatg
tcgtccttggaatcagatattaaaagcatcaacacgttatttgcaaaagcgacaaccatc
tccattatcgtcggggcggctgccggagggctctttctgttaggcggatctgtagagctg
gctgttgcctttaacggtgtgacatacttggtttcggcattttttatcagccgcatcaag
ctgcaatttgtgccgattcaatctgaaaacattaaagaggcctttcagtcttttaaggaa
ggactcaaggaaatcaaaaccaattcattcgtattaaacgccatgtttacgatgattaca
atggctttgctgtggggagttgtgtacagctattttccgattgtcagccgctttctgggt
gacggggaaatcggcaactttattctcacgttctgcatcggcttcggcggctttatcgga
gcggcgcttgtcagcaaatggggctttaacaacaatagaggcctgacgtactttaccgtt
ttatccattgtctcgctggcgctgtttttattcacaccgatattcgctgtttctgtcatc
gcggcgatcctctttttcatcgcgatggaatacggggaagtgcttgcaaaagtgaaggtt
caggaaaatgcggcaaaccagattcaagggcgcattttttcagtggccgaagcgtctatc
ggattatgcatttctattggttcaatgttcattaacatcctaagcgctccggtcattatg
gggctgattgtcgtgatcgtatgcggtttgtttttgcatacgaagctcgtcaacaaatcg
tttttggaacgggataacaaaacggagcaaaaaggagtcttttag

DBGET integrated database retrieval system