KEGG   Bacillus subtilis subsp. subtilis 168: BSU37710
Entry
BSU37710          CDS       T00010                                 

Gene name
bacD
Definition
(RefSeq) alanine-anticapsin ligase BacD
  KO
K13037  L-alanine-L-anticapsin ligase [EC:6.3.2.49]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00998  Biosynthesis of various secondary metabolites - part 2
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSU37710 (bacD)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.49  L-alanine---L-anticapsin ligase
     BSU37710 (bacD)
SSDB
Motif
Pfam: ATP-grasp_4 Dala_Dala_lig_C ATPgrasp_N GARS_A CPSase_L_D2
Other DBs
NCBI-GeneID: 937214
NCBI-ProteinID: NP_391651
Pasteur: BG10629
BSORF: BG10629
UniProt: P39641 A0A6M3ZLH0
Structure
PDB: 
3WNZ 3WO0 3WO1 3VMM

Position
complement(3870668..3872086)
AA seq 472 aa
MERKTVLVIADLGGCPPHMFYKSAAEKYNLVSFIPRPFAITASHAALIEKYSVAVIKDKD
YFKSLADFEHPDSIYWAHEDHNKPEEEVVEQIVKVAEMFGADAITTNNELFIAPMAKACE
RLGLRGAGVQAAENARDKNKMRDAFNKAGVKSIKNKRVTTLEDFRAALEEIGTPLILKPT
YLASSIGVTLITDTETAEDEFNRVNDYLKSINVPKAVTFEAPFIAEEFLQGEYGDWYQTE
GYSDYISIEGIMADGEYFPIAIHDKTPQIGFTETSHITPSILDEEAKKKIVEAAKKANEG
LGLQNCATHTEIKLMKNREPGLIESAARFAGWNMIPNIKKVFGLDMAQLLLDVLCFGKDA
DLPDGLLDQEPYYVADCHLYPQHFKQNGQIPETAEDLVIEAIDIPDGLLKGDTEIVSFSA
AAPGTSVDLTLFEAFNSIAAFELKGSNSQDVAESIRQIQQHAKLTAKYVLPV
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggagagaaaaacagtattggtcatcgctgatcttggaggctgcccgccgcacatgttt
tataaaagcgctgctgaaaaatataacctggtcagctttattccaagaccttttgcaatt
acagcctcccatgcagcattgattgaaaaatactcggtcgcggtcataaaagataaagac
tattttaagagtttagctgattttgaacaccctgattccatttattgggcgcatgaagat
cataacaagcctgaggaagaggtcgtcgagcaaatcgtcaaggttgccgaaatgtttggg
gcggatgccatcacaacaaacaatgaattattcattgctccgatggcgaaagcctgtgaa
cgtctgggcttgagaggtgccggcgtgcaggcagccgaaaatgccagagataaaaataaa
atgagggacgcttttaataaggccggagtcaaatcgatcaaaaacaaacgagtcacaact
cttgaagatttccgtgctgctcttgaagagatcggcacacctcttatcttaaagcctaca
tacttagcgagttctatcggtgtaacgctgattacggacactgagacggcagaagatgaa
tttaacagagtcaatgactatctgaaatcaattaacgtgccaaaggcggttacgtttgaa
gcgccgtttatcgctgaagaatttttacagggtgagtacggagactggtatcaaacagaa
gggtactccgactatatcagtatagaaggcatcatggctgacggtgagtatttcccgatc
gccattcatgataaaacgccgcaaatcgggtttacagagacatcccacattacgccgtcc
attctggatgaagaggcaaaaaagaaaattgtcgaagctgccaaaaaggcaaatgaaggg
cttggactgcaaaattgcgcaacacatacagagatcaagctaatgaaaaacagagaaccg
ggtttaatagagtcggcagccagatttgccggctggaatatgatccccaatattaaaaag
gtctttggccttgatatggcgcaattattattagatgtcctctgtttcggaaaagacgcc
gatctgccggacggattattggatcaagagccttattatgttgccgactgccatttgtac
ccgcagcatttcaaacaaaatggccaaattcctgaaactgctgaggatttggtcattgaa
gcgatcgatattccggacgggcttttaaaaggggatactgaaatcgtttctttttcggcc
gcagcaccaggcacttcagttgatttgacattgtttgaagctttcaattccattgctgca
tttgaactgaaaggcagtaattcacaggatgtggctgaatcaatcagacaaattcagcag
catgcgaagctgacggcaaagtatgtgctgccagtatga

DBGET integrated database retrieval system