KEGG   Bacillus subtilis subsp. subtilis 168: BSU37730
Entry
BSU37730          CDS       T00010                                 

Gene name
bacB
Definition
(RefSeq) bacilysin biosynthesis protein BacB
  KO
K19547  3-[(4R)-4-hydroxycyclohexa-1,5-dien-1-yl]-2-oxopropanoate isomerase [EC:5.3.3.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00998  Biosynthesis of various secondary metabolites - part 2
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSU37730 (bacB)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.19  3-[(4R)-4-hydroxycyclohexa-1,5-dien-1-yl]-2-oxopropanoate isomerase
     BSU37730 (bacB)
SSDB
Motif
Pfam: Cupin_2 AraC_binding Asp_Arg_Hydrox PLAT
Other DBs
NCBI-GeneID: 937084
NCBI-ProteinID: NP_391653
Pasteur: BG10627
BSORF: BG10627
UniProt: P39639 A0A6M3ZJR3
Structure
PDB: 
3H7J 3H9A 3H7Y

Position
complement(3872869..3873576)
AA seq 235 aa
MKTKEDMQELYFPTPKLIEWENGVRQYSTVRGDTEVLMSYVPPHTNVEPHQHKEVQIGMV
VSGELMMTVGDVTRKMTALESAYIAPPHVPHGARNDTDQEVIAIDIKRLKADETYTSPED
YFLDIFKTRDLLPGMEVTFFVEDWVEIMLAKIPGNGGEMPFHKHRNEQIGICIGGGYDMT
VEGCTVEMKFGTAYFCEPREDHGAINRSEKESKSINIFFPPRYNRAKAKKMKADE
NT seq 708 nt   +upstreamnt  +downstreamnt
atgaaaactaaagaagatatgcaggagctttatttcccgacaccgaaattaattgaatgg
gaaaacggagtgaggcagtattcaaccgtacgaggggatactgaagtattaatgtcttac
gtcccgccgcataccaatgttgaaccccatcagcataaggaggtccaaatcggcatggtc
gtttctggcgagctgatgatgactgtcggagatgtgacaagaaaaatgacagccttggaa
tctgcctatatcgcgccgccgcatgtgcctcacggggcaagaaacgacacagaccaagaa
gtgattgctattgatatcaagcggctgaaagctgatgaaacatatacaagtcctgaggac
tactttttggatattttcaaaacaagagacctgctgccgggcatggaagtcacgttcttt
gttgaggattgggtagaaattatgcttgccaaaatccctggaaatggcggagaaatgcct
ttccataaacatcggaatgaacaaataggcatctgcatcggcggcggctatgacatgacg
gtcgaaggctgcacagtcgagatgaaattcggcacagcctatttctgtgagcctcgcgaa
gatcatggtgccatcaaccgttcagaaaaagaatcaaaatcgattaatatcttcttcccg
ccgcgctataacagggcaaaagcaaaaaaaatgaaggcggatgaatga

DBGET integrated database retrieval system