KEGG   Bacillus subtilis subsp. subtilis 168: BSU37740
Entry
BSU37740          CDS       T00010                                 

Symbol
bacA
Name
(RefSeq) bacilysin biosynthesis protein BacA
  KO
K19546  prephenate decarboxylase [EC:4.1.1.100]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00998  Biosynthesis of various secondary metabolites - part 2
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSU37740 (bacA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.100  prephenate decarboxylase
     BSU37740 (bacA)
SSDB
Motif
Pfam: PDT
Other DBs
NCBI-GeneID: 937216
NCBI-ProteinID: NP_391654
Pasteur: BG10626
BSORF: BG10626
UniProt: P39638 A0A6M4JQA3
Position
complement(3873566..3874180)
AA seq 204 aa
MIILDNSIQTKKRTDSLSKLITVNTLGPEGTSSEYAAKHFISNFTLLQGLNSKLSLHDTF
ESCIERTLQSPLEYTIVPHAYDGIKHFYMRPDLQLLQIFRCDTPMYGLAVRPDFEFRDDM
LDTSVIVSHPSPINLIKYFTRKDVRFKLVNSTSQAARKVKEGLYDIALTNELARQKYGLT
FVKTFKSIPMSWSLFGKGDVDDEN
NT seq 615 nt   +upstreamnt  +downstreamnt
atgattatattggataatagcattcagacaaaaaaaagaactgattcactatccaaactc
attacagtcaacacgctcggccctgaggggacaagcagtgagtacgcagcaaagcatttc
atttccaattttactcttctacaagggctgaacagtaaattgtccttgcatgatactttt
gaatcgtgcatcgaaaggacgctccaaagcccgctggaatataccatcgtcccacatgct
tacgatggcattaagcatttctacatgaggccggatttgcagctattgcagatcttcagg
tgcgatacaccgatgtacggcctggctgttcgtcctgattttgaattcagagacgatatg
cttgatacatctgttattgtttcacatccttcacctattaatttaataaaatattttacc
cgcaaagatgttcgtttcaaactagtcaattcaaccagtcaagccgcaagaaaagtaaaa
gaaggtttgtatgacattgccttaaccaatgagcttgcacggcaaaagtacgggctaacc
tttgtaaaaacattcaaaagcattccaatgagctggtcattatttggaaaaggagacgtt
gatgatgaaaactaa

DBGET integrated database retrieval system