KEGG   Bacillus subtilis subsp. subtilis 168: BSU37750
Entry
BSU37750          CDS       T00010                                 

Symbol
ywfA
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_2 MFS_4 MFS_1_like DUF6234
Other DBs
NCBI-GeneID: 937061
NCBI-ProteinID: NP_391655
Pasteur: BG10625
BSORF: BG10625
UniProt: P39637 A0A6M4JQC6
Position
complement(3874332..3875570)
AA seq 412 aa
MNSNQNNDIKTKHHFPLLLALALTMGVFAAGSEELVISPLLPDLAKAFSSDVSVLALSIS
IYGVMIFIGAPLLVPLGDKYSRELSLLAGLMIFIIGTVICALAQNIFFFFLGRALSGLAA
GAFVPTAYAVVGDRVPYTYRGKVMGLIVSSWSLALIFGVPLGSFIGGVLHWRWTFWIFAL
MGVLVVLLILLEMRRHAQHKNSGKEEIEEPAGTFRDALKVPRVPVYITITFCNMIGFYGM
YSFLGTYLQDVFTGGNTAAGLFIMIYGIGFSMSVITGKIADRIGKMRSLLIALGVISVLL
ACLPYAPASMFLLIASLFIWGLMQSLTVTLLSTILSDCSERHRGKVMVFYSLASNLAVTL
GSALMGPVYVAYGYAAVGLICAAITVLGFVLSVFAYKKYGKLEQKADQSLSQ
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaacagcaatcaaaacaatgacatcaaaacaaaacatcattttccgttattgttggca
ctggctttaacgatgggggtatttgcagccggatctgaagagcttgtgatctcaccgctg
ctgccggatttagcaaaagccttcagctcagatgtcagcgtccttgcgttatctatcagt
atttacggcgttatgatttttatcggtgcgccgcttttggttccattaggcgataaatac
tccagagaactgagcttattggccgggcttatgatttttatcataggaacggtgatatgc
gctttagctcaaaatatttttttcttctttttaggccgggcgctttcgggattggctgcg
ggagcgtttgttccgaccgcttacgcagttgtcggtgatcgtgttccttatacataccgg
ggcaaggtgatgggactgatcgtttcaagctggtcgctggcgctgattttcggagtgccg
ctcggatcatttatcggcggcgtcctgcattggagatggacgttttggattttcgccctg
atgggtgttttagttgttctgctgattctccttgaaatgcgccgccatgcccaacataaa
aacagcggcaaggaagaaatagaagagcccgcaggaacattccgggatgcgctgaaagtc
cctcgtgtacctgtttatatcacaataaccttttgtaatatgattggtttttacggtatg
tattcctttttaggcacctatcttcaggacgtttttaccggaggaaacacggctgcgggc
ttatttatcatgatttatggaatcgggttttccatgagtgtgattacaggaaagatagcc
gaccgcatcggaaaaatgcgctcccttttgattgcgctgggggtcatcagcgttctgctg
gcgtgtttaccatatgcgccggcgtctatgtttctgttaatcgccagcctatttatttgg
ggattaatgcaaagtttgacggtgacgctgctcagcaccattttgagtgactgctcagag
cgtcatcgaggaaaagtcatggtgttttacagtctcgcctcgaatctggccgtgacatta
ggttctgctttaatgggacccgtatatgtggcatacggctatgcagctgtcggattgatt
tgcgccgccatcacagtcctcggatttgtgctcagtgtattcgcatataaaaagtacggc
aaacttgagcagaaggccgatcagtccttatctcaataa

DBGET integrated database retrieval system