KEGG   Bacillus subtilis subsp. subtilis 168: BSU37760
Entry
BSU37760          CDS       T00010                                 

Gene name
rocC
Definition
(RefSeq) amino acid permease RocC
  KO
K02205  arginine/ornithine permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU37760 (rocC)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU37760 (rocC)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 938495
NCBI-ProteinID: NP_391656
Pasteur: BG10624
BSORF: BG10624
UniProt: P39636 A0A6M4JQC9
Position
complement(3875780..3877192)
AA seq 470 aa
MQNHKNELQRSMKSRHLFMIALGGVIGTGLFLGSGFTISQAGPLGAIAAYIIGGFLMYLV
MLCLGELAVAMPVAGSFQAYATKFLGQSTGFMIGWLYWFSWANTVGLELTSAGILMQRWL
PSVPIWIWCLVFGIVIFLINALSVRSFAEMEFWFSSIKVAAIILFIVIGGAAVFGLIDFK
GGQETPFLSNFMTDRGLFPNGVLAVMFTLVMVNFSFQGTELVGIAAGESESPEKTLPKSI
RNVIWRTLFFFVLAMFVLVAILPYKTAGVIESPFVAVLDQIGIPFSADIMNFVILTAILS
VANSGLYAASRMMWSLSSNQMGPSFLTRLTKKGVPMNALLITLGISGCSLLTSVMAAETV
YLWCISISGMVTVVAWMSICASQFFFRRRFLAEGGNVNDLEFRTPLYPLVPILGFCLYGC
VLISLIFIPDQRIGLYCGVPIIIFCYAYYHLSIKKRINHETIEKKQTEAQ
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcagaatcataaaaatgaattgcagcgcagcatgaaaagcaggcatttgtttatgatt
gctttgggaggggtgattggcactgggctgtttctaggctctggctttaccattagccag
gcgggaccgctcggcgccattgccgcgtatatcatcggcggatttttaatgtatctcgtc
atgctttgtttaggagaattggctgttgccatgccggtggccggatcgtttcaggcctac
gccactaaatttctgggacagtcgacaggctttatgattggctggctgtattggttcagc
tgggccaatacagtagggttagagctgacgtcagcaggcattttgatgcaaaggtggctg
ccctccgttccgatctggatatggtgcctcgtgttcggcatcgtcatctttttgattaat
gcgctctctgtcagaagctttgcggaaatggaattttggttttcaagcatcaaagtggcg
gcgatcatattatttattgtgattggcggagccgctgtgtttggcttgattgactttaaa
ggcggacaggagacaccctttttgtctaactttatgactgatagagggcttttccctaat
ggggtgctggccgttatgtttacgctggtcatggtaaacttctcgttccagggaacggag
cttgtcggcattgcggcaggggaaagtgaaagcccggaaaaaacactgccaaagtccatt
cgaaatgttatttggcgcacgctgtttttctttgtgctcgctatgttcgtcttggttgcc
atccttccgtacaaaacggcgggggtgattgaaagcccgtttgtagcagtactcgatcaa
atcggcatcccattttcggcagatatcatgaactttgtcatcttaacggccattttatct
gttgctaattcgggattgtatgcggcgtcgcgtatgatgtggtcactttcatcaaatcaa
atgggtccctcctttctcaccagactgacaaaaaaaggcgtgccgatgaatgccctgctg
attacgctaggcatttcaggctgttcgctgctgacaagtgtcatggctgcagaaacagtg
tatttatggtgtatctcaatctcgggcatggtgacagttgtcgcgtggatgtccatttgt
gcgtcgcaatttttctttcgcaggcgtttcctggcagaaggcggaaatgtgaatgatctg
gagttcagaacgccgctttatccgctagtcccgattctcggattttgtttatatggctgc
gtgttgatcagccttattttcattccggatcaaagaattggcttatactgcggtgtgccg
atcattattttctgttatgcatactatcatctaagcatcaaaaagcgtataaatcatgaa
acgattgaaaaaaagcagacagaggcgcaatag

DBGET integrated database retrieval system