KEGG   Bacillus subtilis subsp. subtilis 168: BSU37770Help
Entry
BSU37770          CDS       T00010                                 

Gene name
rocB
Definition
(RefSeq) arginine utilization protein RocB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M28 Rsbr_N
Motif
Other DBs
NCBI-GeneID: 937220
NCBI-ProteinID: NP_391657
Pasteur: BG10623
BSORF: BG10623
UniProt: P39635
Position
complement(3877192..3878892)
Genome map
AA seq 566 aa AA seqDB search
MQYTKISHMNPAERVEALTASLVSLSSVNGTVGEGTKADFIKEVITSYPYFQENPSHVWE
QAIPNDPYKRKNIFAFIKGHGESRNTVIYHAHLDTVGIEDFGPLKDIAFDCEKLAEYFSR
YEFDQDVQRDAKSGEWMFGRGSVDMQSGIAVHLANLLHFSENLETLPGNVLFMANPDEES
QHSGILASISELNRLKKEKQLHYLAAINTDFITPLYDGDQTRYIYTGAAGKLLPCFYIYG
REVHVGDTLAGIDPNFISSEITSRLHNNIHLAEKVEGELVLPPSCLYQRDNKESYNVQTA
VSTSLYFNCFIYERTAKEMMDLLIEVTEEACRETEQKLSDYYEEYVKRANLPKKHLSWGI
QVYSLEQYLEKLRNRGIDPEQCIEQTFKANEHLELRMRCFQAIEELQKLDPDQGAKVILF
YAPPYLPHNYLKEDSARDQLLQHVIKEAADKTAESTGETFVFKKFFPYLADGSFLSLHET
DGEIDSFIRNFPGWNMIGTIPFKDIRKLNIPSINMGVYGKDGHKWTERVYKPYTFHVLPL
LIQQTTVHLLQSYRMTITAKEPKGEG
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatacaaaaatcagtcacatgaatccggctgaaagagtggaggcgctgacagca
tctctggtcagcctcagcagcgtgaacggcaccgttggagaagggacaaaagcagatttc
atcaaagaagtgatcacgagctatccttattttcaggaaaaccccagtcatgtgtgggaa
caggccattcccaatgacccatacaaacgcaaaaatatttttgcgtttattaaaggacat
ggagaaagccgaaatacagtcatttaccatgcccatctggatacagttggaattgaagat
ttcggccctttaaaggatatcgcttttgattgtgagaaattggccgagtatttcagccgc
tatgagttcgatcaggatgttcagcgggatgccaaatcaggcgagtggatgttcggaaga
ggatctgtcgatatgcaaagcggcatcgccgtgcatttagccaatctcctgcatttttcg
gagaaccttgagacgttgccgggaaatgtattgtttatggccaatcccgatgaggagagc
cagcattcgggcattctcgccagcatttcagagctgaaccggctaaaaaaagaaaaacag
cttcactatttggctgctattaatacggattttattaccccgctttacgatggtgatcag
acaagatatatctataccggagccgcgggaaaactgttgccttgcttttacatttacggg
cgtgaagtccatgttggcgatacactggcagggattgacccaaatttcatttcatctgaa
atcacaagccgtctccacaataacatccatctggcagaaaaggttgaaggggagttggtt
ctgcccccatcctgtttgtatcagcgtgataacaaggaatcctataatgtgcaaacggct
gtcagcaccagcttgtatttcaattgttttatttatgaaagaacagcaaaagaaatgatg
gatttgcttattgaagtcactgaggaagcatgccgggagacagaacaaaaattatcagat
tattacgaagaatatgtaaaaagagccaacctgccaaagaaacatttatcatggggcatt
caagtgtatagcctggagcaatacttagaaaagctgagaaaccggggaatagatcccgag
cagtgtatcgagcagacattcaaagccaacgagcaccttgaacttcgcatgagatgcttt
caggcaatcgaagagcttcaaaagcttgaccccgatcaaggcgcaaaagtcattctattt
tacgcacctccttacctgccgcataactatttgaaagaagatagcgcaagagatcagctt
ttgcagcatgtgattaaagaagcggctgacaaaaccgctgaatcgacaggcgaaacattt
gtcttcaaaaagtttttcccctacttggcagacggcagttttttatcactgcacgaaacc
gatggcgaaattgattcttttatcaggaacttccctgggtggaatatgattgggaccatt
ccgttcaaagacatacgcaagctgaatattccatccattaatatgggcgtgtacggaaaa
gacggccataaatggacagaacgagtctataaaccgtacacatttcatgtattgcctctc
ctcatacagcaaaccaccgttcatcttttgcaaagctaccggatgaccatcacggcaaaa
gaaccaaagggggaaggatga

DBGET integrated database retrieval system