KEGG   Bacillus subtilis subsp. subtilis 168: BSU37800
Entry
BSU37800          CDS       T00010                                 

Gene name
yweA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: BslA DUF2963
Other DBs
NCBI-GeneID: 937223
NCBI-ProteinID: NP_391660
Pasteur: BG10620
BSORF: BG10620
UniProt: P39632 A0A6M3ZHE7
Structure
PDB: 
5MKD

Position
complement(3882191..3882655)
AA seq 154 aa
MLKRTSFVSSLFISSAVLLSILLPSGQAHAQSASIEAKTVNSTKEWTISDIEVTYKPNAV
LSLGAVEFQFPDGFHATTRDSVNGRTLKETQILNDGKTVRLPLTLDLLGASEFDLVMVRK
TLPRAGTYTIKGDVVNGLGIGSFYAETQLVIDPR
NT seq 465 nt   +upstreamnt  +downstreamnt
atgctaaaaagaacttcattcgtatcttcattattcatcagttcagctgttttactatca
atcttacttccttcgggccaagctcatgcacagtctgcatcaatcgaggcaaaaacagtt
aacagcacgaaagagtggaccatttctgatattgaagtgacatataaaccaaatgcggtg
ctttctcttggagcggtagaatttcaatttcctgacgggtttcatgctacgacaagagat
tcagtgaatggaagaacactgaaagaaacacagattttaaacgatggaaaaacagtcaga
ctcccgcttacgcttgatttgttaggcgcatccgaatttgaccttgtcatggtgcgtaaa
actcttcctcgcgcaggcacttacacgattaaaggcgatgtagtaaacggtttgggaatc
ggcagtttttatgctgaaacgcagctggtgattgatccccgttaa

DBGET integrated database retrieval system